BLASTX nr result
ID: Glycyrrhiza23_contig00031419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00031419 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612353.1| Pentatricopeptide repeat-containing protein ... 84 1e-14 >ref|XP_003612353.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513688|gb|AES95311.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 237 SDHAPYILLSNIHIGEGKWEEALKCREKMAKIRVKKDPGSSWLI 106 SDHAPYILLSNI+I EG WEEAL CR+KMAKIRVKKDPG+SWLI Sbjct: 752 SDHAPYILLSNIYIEEGNWEEALNCRKKMAKIRVKKDPGNSWLI 795