BLASTX nr result
ID: Glycyrrhiza23_contig00031393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00031393 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528642.1| PREDICTED: probable histone-arginine methylt... 65 6e-09 ref|XP_003609675.1| hypothetical protein MTR_4g119920 [Medicago ... 57 2e-06 >ref|XP_003528642.1| PREDICTED: probable histone-arginine methyltransferase 1.4-like [Glycine max] Length = 1010 Score = 65.1 bits (157), Expect = 6e-09 Identities = 39/70 (55%), Positives = 44/70 (62%) Frame = +2 Query: 53 DSETHHTREVPLSSPMASAHCSFSSLLAPSTTRRTPPLIIVASNASHRKNYLRPKILKTL 232 DS+ R PMA+AH + SSLLAP T RT L I S+ HRKN+LRPKILK L Sbjct: 579 DSDCGAGRSCRAEVPMATAHNTLSSLLAPQATGRTT-LRIPISSKRHRKNHLRPKILKIL 637 Query: 233 TKPCPPAPPL 262 TKP P A PL Sbjct: 638 TKPYPLALPL 647 >ref|XP_003609675.1| hypothetical protein MTR_4g119920 [Medicago truncatula] gi|355510730|gb|AES91872.1| hypothetical protein MTR_4g119920 [Medicago truncatula] Length = 564 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/48 (68%), Positives = 34/48 (70%) Frame = +2 Query: 98 MASAHCSFSSLLAPSTTRRTPPLIIVASNASHRKNYLRPKILKTLTKP 241 MA AHC FS AP TTRR IIV+S RKNYLRPKILKTLTKP Sbjct: 1 MAIAHCFFS-FHAPFTTRRN---IIVSSKTGQRKNYLRPKILKTLTKP 44