BLASTX nr result
ID: Glycyrrhiza23_contig00031084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00031084 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534744.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_003534743.1| PREDICTED: pentatricopeptide repeat-containi... 78 7e-13 ref|XP_003547290.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 ref|XP_004139516.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-10 ref|XP_003610579.1| Pentatricopeptide repeat-containing protein ... 67 2e-09 >ref|XP_003534744.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 705 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -2 Query: 293 SHLKELNAPFREAPDKAGWFLVKKEAAKTWLQSRGSTETVAALDSPVLGAPTMALHF 123 SHL+ELNAPF +APDKAGWFLV KEAAK+WL+SRGS ET+ L+S V GA T+AL + Sbjct: 648 SHLRELNAPFHQAPDKAGWFLVTKEAAKSWLESRGSAETIDDLNSQVSGASTVALQY 704 >ref|XP_003534743.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 693 Score = 78.2 bits (191), Expect = 7e-13 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 293 SHLKELNAPFREAPDKAGWFLVKKEAAKTWLQSRGSTETVAALDSPVLGAPTMAL 129 SHLKELNAPF E+ KAGWFLV K AAK+WL+SR STE++A L+S VLG PTM L Sbjct: 641 SHLKELNAPFHES--KAGWFLVTKAAAKSWLESRDSTESIAGLNSLVLGVPTMVL 693 >ref|XP_003547290.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] Length = 692 Score = 72.0 bits (175), Expect = 5e-11 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = -2 Query: 293 SHLKELNAPFREAPDKAGWFLVKKEAAKTWLQSRGSTETVAALDSPVLGAPTMAL 129 S LKELNAPF EA KAGWFLV K AAK WL+SR STE++A L+ VL PTMAL Sbjct: 640 SRLKELNAPFHEA--KAGWFLVTKAAAKLWLESRDSTESIAGLNFLVLDVPTMAL 692 >ref|XP_004139516.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Cucumis sativus] gi|449492820|ref|XP_004159111.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Cucumis sativus] Length = 704 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 293 SHLKELNAPFREAPDKAGWFLVKKEAAKTWLQSRGSTETVAA 168 SHLKELNAPF EAP+K GWFL K AAK+WL+SR S E VAA Sbjct: 663 SHLKELNAPFHEAPEKVGWFLTTKVAAKSWLESRSSPELVAA 704 >ref|XP_003610579.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355511634|gb|AES92776.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 706 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -2 Query: 293 SHLKELNAPFREAPDKAGWFLVKKEAAKTWLQSRGSTETVAA 168 SH+KEL+APFRE+PDKAGWFL + A K+W++SRGS++ VAA Sbjct: 665 SHMKELDAPFRESPDKAGWFLTTQVAVKSWMESRGSSKLVAA 706