BLASTX nr result
ID: Glycyrrhiza23_contig00030994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030994 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543756.1| PREDICTED: probable receptor-like serine/thr... 97 2e-18 ref|XP_003550670.1| PREDICTED: probable receptor-like serine/thr... 93 3e-17 ref|XP_002331667.1| predicted protein [Populus trichocarpa] gi|2... 87 2e-15 ref|XP_002534342.1| conserved hypothetical protein [Ricinus comm... 85 7e-15 ref|XP_003610193.1| Nodulation receptor kinase [Medicago truncat... 73 3e-11 >ref|XP_003543756.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Glycine max] Length = 604 Score = 96.7 bits (239), Expect = 2e-18 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 5 VLELLTSGQDCEVGKSWRIPKFTSDELDDYSMVFGYDVPSDISLEDYL 148 VLELLTSGQ+ EVGKSWRIPKFTSDELDDYSMVFGYDVPSD+SLEDYL Sbjct: 557 VLELLTSGQESEVGKSWRIPKFTSDELDDYSMVFGYDVPSDVSLEDYL 604 >ref|XP_003550670.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670-like [Glycine max] Length = 605 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 5 VLELLTSGQDCEVGKSWRIPKFTSDELDDYSMVFGYDVPSDISLEDYL 148 VLELLTSGQ+ E+GKSWRIPKF S+ELDDYSMVFGYDVPSDISLEDYL Sbjct: 558 VLELLTSGQESEIGKSWRIPKFISEELDDYSMVFGYDVPSDISLEDYL 605 >ref|XP_002331667.1| predicted protein [Populus trichocarpa] gi|222874086|gb|EEF11217.1| predicted protein [Populus trichocarpa] Length = 613 Score = 86.7 bits (213), Expect = 2e-15 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 5 VLELLTSGQDCEVGKSWRIPKFTSDELDDYSMVFGYDVPSDISLEDYL 148 VLELLTSG D EV +SWR+PKFTSDELDDYSM+FGY+VP DI+LEDYL Sbjct: 566 VLELLTSGHDSEVARSWRMPKFTSDELDDYSMIFGYEVPVDIALEDYL 613 >ref|XP_002534342.1| conserved hypothetical protein [Ricinus communis] gi|223525458|gb|EEF28040.1| conserved hypothetical protein [Ricinus communis] Length = 563 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 5 VLELLTSGQDCEVGKSWRIPKFTSDELDDYSMVFGYDVPSDISLEDYL 148 VLELLTSG D EV K+WR+PKFTS++LDDYSMVFGYDVP DI LEDYL Sbjct: 516 VLELLTSGSDSEVAKTWRMPKFTSEDLDDYSMVFGYDVPVDIVLEDYL 563 >ref|XP_003610193.1| Nodulation receptor kinase [Medicago truncatula] gi|355511248|gb|AES92390.1| Nodulation receptor kinase [Medicago truncatula] Length = 621 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 5 VLELLTSGQDCEVGKSWRIPKFTSDELDDYSMVFGYDVPSDISL 136 VLELLT+GQD EVGKSWRIPKFTSDELDDYSM+FG ++SL Sbjct: 526 VLELLTNGQDYEVGKSWRIPKFTSDELDDYSMIFGNHCCEEVSL 569