BLASTX nr result
ID: Glycyrrhiza23_contig00030830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030830 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36953.3| unnamed protein product [Vitis vinifera] 84 9e-15 ref|XP_002270605.1| PREDICTED: histone-lysine N-methyltransferas... 84 9e-15 ref|XP_002515279.1| enhancer of zeste, ezh, putative [Ricinus co... 84 2e-14 ref|XP_002320296.1| SET domain protein [Populus trichocarpa] gi|... 82 6e-14 gb|ABK94393.1| unknown [Populus trichocarpa] 82 6e-14 >emb|CBI36953.3| unnamed protein product [Vitis vinifera] Length = 382 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = -1 Query: 324 RVGIFAKERIEAGEELFYDYHYGPEHRPAWRVKLLDEESRRDKSIVSQGKGKKHQSH 154 RVGIFAKE IEAGEELFYDY YGP+ PAW K E S+RD S VSQG+ KKHQSH Sbjct: 328 RVGIFAKEHIEAGEELFYDYRYGPDQAPAWARK--PEASKRDDSAVSQGRAKKHQSH 382 >ref|XP_002270605.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Vitis vinifera] Length = 906 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = -1 Query: 324 RVGIFAKERIEAGEELFYDYHYGPEHRPAWRVKLLDEESRRDKSIVSQGKGKKHQSH 154 RVGIFAKE IEAGEELFYDY YGP+ PAW K E S+RD S VSQG+ KKHQSH Sbjct: 852 RVGIFAKEHIEAGEELFYDYRYGPDQAPAWARK--PEASKRDDSAVSQGRAKKHQSH 906 >ref|XP_002515279.1| enhancer of zeste, ezh, putative [Ricinus communis] gi|223545759|gb|EEF47263.1| enhancer of zeste, ezh, putative [Ricinus communis] Length = 884 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/57 (71%), Positives = 44/57 (77%) Frame = -1 Query: 324 RVGIFAKERIEAGEELFYDYHYGPEHRPAWRVKLLDEESRRDKSIVSQGKGKKHQSH 154 RVGIFAKE IEA EELFYDY YGP+ PAW K E SRRD+S VSQG+ KKHQSH Sbjct: 830 RVGIFAKEHIEASEELFYDYRYGPDQAPAWARK--PEGSRRDESTVSQGRAKKHQSH 884 >ref|XP_002320296.1| SET domain protein [Populus trichocarpa] gi|222861069|gb|EEE98611.1| SET domain protein [Populus trichocarpa] Length = 812 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = -1 Query: 324 RVGIFAKERIEAGEELFYDYHYGPEHRPAWRVKLLDEESRRDKSIVSQGKGKKHQSH 154 RVGIFA ERIEA EELFYDY YGP+ PAW K E S+RD S VSQG+ KKHQSH Sbjct: 758 RVGIFANERIEASEELFYDYRYGPDQTPAWARK--PEGSKRDDSTVSQGRAKKHQSH 812 >gb|ABK94393.1| unknown [Populus trichocarpa] Length = 62 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = -1 Query: 324 RVGIFAKERIEAGEELFYDYHYGPEHRPAWRVKLLDEESRRDKSIVSQGKGKKHQSH 154 RVGIFA ERIEA EELFYDY YGP+ PAW K E S+RD S VSQG+ KKHQSH Sbjct: 8 RVGIFANERIEASEELFYDYRYGPDQTPAWARK--PEGSKRDDSTVSQGRAKKHQSH 62