BLASTX nr result
ID: Glycyrrhiza23_contig00030774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030774 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594881.1| Polygalacturonase QRT3 [Medicago truncatula]... 125 3e-27 ref|XP_003534867.1| PREDICTED: polygalacturonase QRT3-like [Glyc... 123 2e-26 ref|XP_003543877.1| PREDICTED: polygalacturonase QRT3-like [Glyc... 110 9e-23 ref|XP_003554934.1| PREDICTED: polygalacturonase QRT3-like [Glyc... 106 2e-21 ref|XP_002303344.1| predicted protein [Populus trichocarpa] gi|2... 98 6e-19 >ref|XP_003594881.1| Polygalacturonase QRT3 [Medicago truncatula] gi|355483929|gb|AES65132.1| Polygalacturonase QRT3 [Medicago truncatula] Length = 497 Score = 125 bits (315), Expect = 3e-27 Identities = 61/67 (91%), Positives = 65/67 (97%) Frame = +1 Query: 1 GTSWTVDFNNILLFPNLIKNVQYSLSSTGSTFPNHALRNVSENRVVIETNEAVTANVFVA 180 GTSW VDFNNILLFPNLIKNVQYSLSSTGS+FPNHA+RNVS+NRVVIETNEAV ANVFVA Sbjct: 431 GTSWNVDFNNILLFPNLIKNVQYSLSSTGSSFPNHAIRNVSDNRVVIETNEAVAANVFVA 490 Query: 181 VDQSMAS 201 VDQSM+S Sbjct: 491 VDQSMSS 497 >ref|XP_003534867.1| PREDICTED: polygalacturonase QRT3-like [Glycine max] Length = 472 Score = 123 bits (308), Expect = 2e-26 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +1 Query: 1 GTSWTVDFNNILLFPNLIKNVQYSLSSTGSTFPNHALRNVSENRVVIETNEAVTANVFVA 180 GTSW+VDFNN+LLFPNLIKNVQYSLSS+GSTFPNHALRNVSENRVVIETNEAV ANVFV Sbjct: 406 GTSWSVDFNNVLLFPNLIKNVQYSLSSSGSTFPNHALRNVSENRVVIETNEAVAANVFVT 465 Query: 181 VDQSMAS 201 VDQS S Sbjct: 466 VDQSALS 472 >ref|XP_003543877.1| PREDICTED: polygalacturonase QRT3-like [Glycine max] Length = 489 Score = 110 bits (276), Expect = 9e-23 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = +1 Query: 1 GTSWTVDFNNILLFPNLIKNVQYSLSSTGSTFPNHALRNVSENRVVIETNEAVTANVFVA 180 GTSWT DFN +LLFPNLIK+V YSLS++G+TFPNHALRNVS+NRVVIET+EAV ANVFV Sbjct: 423 GTSWTADFNKVLLFPNLIKHVVYSLSASGNTFPNHALRNVSQNRVVIETDEAVNANVFVT 482 Query: 181 VDQSMAS 201 VDQ AS Sbjct: 483 VDQGNAS 489 >ref|XP_003554934.1| PREDICTED: polygalacturonase QRT3-like [Glycine max] Length = 463 Score = 106 bits (264), Expect = 2e-21 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = +1 Query: 1 GTSWTVDFNNILLFPNLIKNVQYSLSSTGSTFPNHALRNVSENRVVIETNEAVTANVFVA 180 GT+WT DF +LLFPNLIK+V YSLS+ G+TFPNHALRNVS+NRVVIET+EAV ANVFV Sbjct: 397 GTTWTSDFTKVLLFPNLIKHVVYSLSANGNTFPNHALRNVSQNRVVIETDEAVNANVFVT 456 Query: 181 VDQSMAS 201 VDQ AS Sbjct: 457 VDQGNAS 463 >ref|XP_002303344.1| predicted protein [Populus trichocarpa] gi|222840776|gb|EEE78323.1| predicted protein [Populus trichocarpa] Length = 489 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/67 (68%), Positives = 60/67 (89%) Frame = +1 Query: 1 GTSWTVDFNNILLFPNLIKNVQYSLSSTGSTFPNHALRNVSENRVVIETNEAVTANVFVA 180 GTSWT+DF+ +LLFPNLI +VQYS+SS+G+ FP+HALRNVSENRVVIE++ AV A+VFV Sbjct: 423 GTSWTIDFSPVLLFPNLIDHVQYSVSSSGTLFPSHALRNVSENRVVIESDVAVPASVFVT 482 Query: 181 VDQSMAS 201 V+Q ++S Sbjct: 483 VNQGVSS 489