BLASTX nr result
ID: Glycyrrhiza23_contig00030759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030759 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containi... 79 4e-13 ref|XP_003623530.1| Pentatricopeptide repeat-containing protein ... 78 7e-13 >ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Glycine max] Length = 499 Score = 79.0 bits (193), Expect = 4e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 104 MVRHPLSKSANKYLRKFRKWPHSPYKTSWHHNFG 3 MVRHPLSK ANKYLRKF+KWPHSPYKTSWHHNFG Sbjct: 1 MVRHPLSKRANKYLRKFKKWPHSPYKTSWHHNFG 34 >ref|XP_003623530.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498545|gb|AES79748.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 653 Score = 78.2 bits (191), Expect = 7e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -1 Query: 104 MVRHPLSKSANKYLRKFRKWPHSPYKTSWHHNFG 3 MVR+PLSK+ANKYLRKFRKWPHSPYKTSWHHNFG Sbjct: 1 MVRNPLSKTANKYLRKFRKWPHSPYKTSWHHNFG 34