BLASTX nr result
ID: Glycyrrhiza23_contig00030638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030638 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002984900.1| hypothetical protein SELMODRAFT_121248 [Sela... 56 4e-06 ref|XP_002985957.1| hypothetical protein SELMODRAFT_424924 [Sela... 56 4e-06 >ref|XP_002984900.1| hypothetical protein SELMODRAFT_121248 [Selaginella moellendorffii] gi|300147486|gb|EFJ14150.1| hypothetical protein SELMODRAFT_121248 [Selaginella moellendorffii] Length = 417 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 IVWRCSLVFSSLDKIVSVLIHLLPGKLDPTL 95 IVWRCSLVFSS+DKI+SVLIHLLPGK T+ Sbjct: 121 IVWRCSLVFSSIDKIISVLIHLLPGKFHSTV 151 >ref|XP_002985957.1| hypothetical protein SELMODRAFT_424924 [Selaginella moellendorffii] gi|300146464|gb|EFJ13134.1| hypothetical protein SELMODRAFT_424924 [Selaginella moellendorffii] Length = 435 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 IVWRCSLVFSSLDKIVSVLIHLLPGKLDPTL 95 IVWRCSLVFSS+DKI+SVLIHLLPGK T+ Sbjct: 138 IVWRCSLVFSSIDKIISVLIHLLPGKFHSTV 168