BLASTX nr result
ID: Glycyrrhiza23_contig00030505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030505 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608125.1| hypothetical protein MTR_4g087870 [Medicago ... 143 2e-32 >ref|XP_003608125.1| hypothetical protein MTR_4g087870 [Medicago truncatula] gi|355509180|gb|AES90322.1| hypothetical protein MTR_4g087870 [Medicago truncatula] Length = 221 Score = 143 bits (360), Expect = 2e-32 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 3/101 (2%) Frame = -2 Query: 350 TLVLLLSFCVSETRPLRNHDPISFHLPS-NSLFLSTVKHYLYPGSEDRSLAKMDK--LST 180 TL+LLLSF VSETRPLRNH P SFH P+ +SLFL TVKHYLY GS+ RSLAK+D L T Sbjct: 10 TLLLLLSFSVSETRPLRNHGPFSFHFPATSSLFLGTVKHYLYSGSKGRSLAKIDHKILKT 69 Query: 179 SAKVSFSIKWIRSSNATRSQYHQPLRVSPGGPDAHHHFKVT 57 SAKVSFSI + R SNATR++Y +PLRVSPGGPDAHHHFKVT Sbjct: 70 SAKVSFSIGF-RESNATRNRYFKPLRVSPGGPDAHHHFKVT 109