BLASTX nr result
ID: Glycyrrhiza23_contig00030495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030495 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530332.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-27 ref|XP_003617724.1| Pentatricopeptide repeat-containing protein ... 120 9e-26 ref|XP_004155892.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_004134313.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CBI26162.3| unnamed protein product [Vitis vinifera] 86 3e-15 >ref|XP_003530332.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Glycine max] Length = 577 Score = 127 bits (318), Expect = 1e-27 Identities = 61/74 (82%), Positives = 66/74 (89%) Frame = -3 Query: 227 RTDLVWTLYEQMMESGVVANIDVETVGYLIKAFCAENKVFKGYELLRQLLENGLCPDSTV 48 RTDLVWTLYEQMMESGVVA+I+VETVGYLI AFCAE KV KGYELL++LLENGLCPD+ V Sbjct: 192 RTDLVWTLYEQMMESGVVASINVETVGYLIMAFCAEYKVLKGYELLKELLENGLCPDNVV 251 Query: 47 FNSLITGFIKERQY 6 FN LI GF KE QY Sbjct: 252 FNELIRGFCKEGQY 265 >ref|XP_003617724.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519059|gb|AET00683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 861 Score = 120 bits (302), Expect = 9e-26 Identities = 58/74 (78%), Positives = 64/74 (86%) Frame = -3 Query: 227 RTDLVWTLYEQMMESGVVANIDVETVGYLIKAFCAENKVFKGYELLRQLLENGLCPDSTV 48 RTDLVW LYE M+ESGV NIDVETVG LIKAFCAENKVF GYELLRQ+LE GLC D+TV Sbjct: 179 RTDLVWKLYELMIESGVGVNIDVETVGCLIKAFCAENKVFNGYELLRQVLEKGLCVDNTV 238 Query: 47 FNSLITGFIKERQY 6 FN+LI GF K++QY Sbjct: 239 FNALINGFCKQKQY 252 >ref|XP_004155892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Cucumis sativus] Length = 638 Score = 100 bits (248), Expect = 2e-19 Identities = 45/74 (60%), Positives = 59/74 (79%) Frame = -3 Query: 227 RTDLVWTLYEQMMESGVVANIDVETVGYLIKAFCAENKVFKGYELLRQLLENGLCPDSTV 48 RTDL+W LYE MME+GV ++D+ETVGYLI+AFC +NKV + YE+LRQ LE+GL P + Sbjct: 241 RTDLIWKLYEGMMETGVQKDVDIETVGYLIQAFCNDNKVSRAYEILRQSLEDGLTPCNDA 300 Query: 47 FNSLITGFIKERQY 6 FN LI+GF KE+ + Sbjct: 301 FNKLISGFCKEKNH 314 >ref|XP_004134313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Cucumis sativus] Length = 602 Score = 100 bits (248), Expect = 2e-19 Identities = 45/74 (60%), Positives = 59/74 (79%) Frame = -3 Query: 227 RTDLVWTLYEQMMESGVVANIDVETVGYLIKAFCAENKVFKGYELLRQLLENGLCPDSTV 48 RTDL+W LYE MME+GV ++D+ETVGYLI+AFC +NKV + YE+LRQ LE+GL P + Sbjct: 205 RTDLIWKLYEGMMETGVQKDVDIETVGYLIQAFCNDNKVSRAYEILRQSLEDGLTPCNDA 264 Query: 47 FNSLITGFIKERQY 6 FN LI+GF KE+ + Sbjct: 265 FNKLISGFCKEKNH 278 >emb|CBI26162.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = -3 Query: 227 RTDLVWTLYEQMMESGVVANIDVETVGYLIKAFCAENKVFKGYELLRQLLENGLCPDSTV 48 R D VW LY +M+ES VVA DV TVGYL++AFC EN++ G+ LLR++LE+G+ P + Sbjct: 242 RIDFVWELYGEMVESSVVA--DVHTVGYLVQAFCDENRISDGHNLLRRVLEDGVVPRNAA 299 Query: 47 FNSLITGFIKERQY 6 FN LI+GF K++ Y Sbjct: 300 FNKLISGFCKDKAY 313