BLASTX nr result
ID: Glycyrrhiza23_contig00030357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030357 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_003621319.1| Pentatricopeptide repeat-containing protein ... 57 1e-06 >ref|XP_003552546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 QFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVPGIHR 112 +FTVFDQSHPKS+DIY M+DRLVQDLRQVGYVP IH+ Sbjct: 568 EFTVFDQSHPKSDDIYQMIDRLVQDLRQVGYVPMIHQ 604 >ref|XP_003530418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Glycine max] Length = 604 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 QFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVPGIHR 112 +FTVFDQSHPKS+DIY M+DRLVQDLRQVGYVP IH+ Sbjct: 568 EFTVFDQSHPKSDDIYKMIDRLVQDLRQVGYVPMIHQ 604 >ref|XP_003621319.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496334|gb|AES77537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 605 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 QFTVFDQSHPKSEDIYDMVDRLVQDLRQVGYVP 100 +FTV D SHPKS DIY+M+DRLV DLRQVGYVP Sbjct: 570 EFTVRDWSHPKSGDIYNMIDRLVHDLRQVGYVP 602