BLASTX nr result
ID: Glycyrrhiza23_contig00030356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030356 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615441.1| hypothetical protein MTR_5g068060 [Medicago ... 88 8e-16 ref|XP_002329199.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus c... 62 4e-08 ref|XP_002509932.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 emb|CBI34458.3| unnamed protein product [Vitis vinifera] 59 3e-07 >ref|XP_003615441.1| hypothetical protein MTR_5g068060 [Medicago truncatula] gi|355516776|gb|AES98399.1| hypothetical protein MTR_5g068060 [Medicago truncatula] Length = 960 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 142 MSGESAPKPRVVLCPKCRQLLQEPPDYDLYKCGGCGTVLQAKKRKSR 2 MS ESAPKPR VLCPKCR LLQEP ++D+YKCGGCGT LQAKKRKSR Sbjct: 1 MSSESAPKPRFVLCPKCRLLLQEPQNFDVYKCGGCGTTLQAKKRKSR 47 >ref|XP_002329199.1| predicted protein [Populus trichocarpa] gi|222870980|gb|EEF08111.1| predicted protein [Populus trichocarpa] Length = 1052 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -3 Query: 142 MSGESAPKPRVVLCPKCRQLLQEPPDYDLYKCGGCGTVLQAKKRKS 5 M+ SA K R V CPKCRQ+L EP D +YKCGGCGT LQ K RKS Sbjct: 1 MNSGSAAKIRFVRCPKCRQVLVEPQDIPVYKCGGCGTHLQVKIRKS 46 >ref|XP_002520886.1| hypothetical protein RCOM_0690150 [Ricinus communis] gi|223540017|gb|EEF41595.1| hypothetical protein RCOM_0690150 [Ricinus communis] Length = 878 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -3 Query: 142 MSGESAPKPRVVLCPKCRQLLQEPPDYDLYKCGGCGTVLQAKKRK 8 MS ++PK R+V CPKCR +L E PD +Y+CGGCGT LQAK +K Sbjct: 1 MSSRTSPKIRLVRCPKCRHILPELPDVPVYECGGCGTRLQAKIKK 45 >ref|XP_002509932.1| conserved hypothetical protein [Ricinus communis] gi|223549831|gb|EEF51319.1| conserved hypothetical protein [Ricinus communis] Length = 934 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 142 MSGESAPKPRVVLCPKCRQLLQEPPDYDLYKCGGCGTVLQAKKR 11 M+ E PK R V CPKC LL E P+Y +Y+CGGCG++L+AKK+ Sbjct: 1 MAEEGPPKVRFVRCPKCESLLTELPNYSVYECGGCGSLLRAKKK 44 >emb|CBI34458.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 121 KPRVVLCPKCRQLLQEPPDYDLYKCGGCGTVLQAKKR 11 K RVV CPKC LL E PDY +Y+CGGCG VL+AKK+ Sbjct: 6 KVRVVRCPKCENLLPELPDYPVYQCGGCGAVLRAKKK 42