BLASTX nr result
ID: Glycyrrhiza23_contig00030277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00030277 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547649.1| PREDICTED: F-box/kelch-repeat protein At3g27... 66 3e-09 >ref|XP_003547649.1| PREDICTED: F-box/kelch-repeat protein At3g27150-like [Glycine max] Length = 404 Score = 65.9 bits (159), Expect = 3e-09 Identities = 34/55 (61%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -2 Query: 164 MTNTRTLPIPNFDSGFFLGYHNNSSPSQKMRIIELSPSDGNGSS-SADEPLPQDA 3 MTN + LP+P+F SG YH S +KMR+ ELSPSDGNGSS + DEPLPQDA Sbjct: 1 MTNRKALPVPSFVSGICFSYH---SSQKKMRVRELSPSDGNGSSTNGDEPLPQDA 52