BLASTX nr result
ID: Glycyrrhiza23_contig00029983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029983 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530573.1| PREDICTED: dehydration-responsive element-bi... 93 3e-17 ref|XP_002514246.1| Transcriptional factor TINY, putative [Ricin... 91 1e-16 ref|XP_003630740.1| Ethylene-responsive transcription factor TIN... 90 2e-16 gb|ADE41132.1| AP2 domain class transcription factor [Malus x do... 89 4e-16 ref|XP_002332357.1| AP2/ERF domain-containing transcription fact... 88 8e-16 >ref|XP_003530573.1| PREDICTED: dehydration-responsive element-binding protein 3-like [Glycine max] Length = 242 Score = 92.8 bits (229), Expect = 3e-17 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -1 Query: 170 SYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIREPRKKNRIWLG 3 S SE P P+ KRPK+AR+ S+SKHPV+RGVRMRAWGKWVSEIREPRKKNRIWLG Sbjct: 20 SSSEAHLPAPDQKRPKQARD-SSSKHPVFRGVRMRAWGKWVSEIREPRKKNRIWLG 74 >ref|XP_002514246.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223546702|gb|EEF48200.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 279 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/58 (72%), Positives = 47/58 (81%) Frame = -1 Query: 176 SPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIREPRKKNRIWLG 3 SP+ P+ N ++PKRAR+ SN KHPVYRGVRMR WGKWVSEIREPRKKNRIWLG Sbjct: 39 SPNPVRKPGPEENPRKPKRARDSSN-KHPVYRGVRMRTWGKWVSEIREPRKKNRIWLG 95 >ref|XP_003630740.1| Ethylene-responsive transcription factor TINY [Medicago truncatula] gi|355524762|gb|AET05216.1| Ethylene-responsive transcription factor TINY [Medicago truncatula] Length = 293 Score = 90.1 bits (222), Expect = 2e-16 Identities = 46/61 (75%), Positives = 46/61 (75%) Frame = -1 Query: 185 PKASPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIREPRKKNRIWL 6 PK S S PDP KRPKR RE S HPVYRGVRMRAWGKWVSEIREPRKKNRIWL Sbjct: 10 PKTS---SSAHLPDPVEKRPKRPRE---SNHPVYRGVRMRAWGKWVSEIREPRKKNRIWL 63 Query: 5 G 3 G Sbjct: 64 G 64 >gb|ADE41132.1| AP2 domain class transcription factor [Malus x domestica] Length = 278 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = -1 Query: 152 SPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIREPRKKNRIWLG 3 SP P+ KR KR RE S SKHPVYRGVRMR WGKWVSEIREPRKKNRIWLG Sbjct: 46 SPGPDQKRAKRVRETS-SKHPVYRGVRMRTWGKWVSEIREPRKKNRIWLG 94 >ref|XP_002332357.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] gi|148372069|gb|ABQ62966.1| TINY-like protein [Populus trichocarpa] gi|222832078|gb|EEE70555.1| AP2/ERF domain-containing transcription factor [Populus trichocarpa] Length = 288 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 3/61 (4%) Frame = -1 Query: 176 SPSYSEPQSPDPNGKRPKRAREIS---NSKHPVYRGVRMRAWGKWVSEIREPRKKNRIWL 6 SP+ P+ N ++PKR RE + NSKHPV+RGVRMR WGKWVSEIREPRKKNRIWL Sbjct: 37 SPNPVSKPDPEKNLRKPKRPRETNSSNNSKHPVFRGVRMRTWGKWVSEIREPRKKNRIWL 96 Query: 5 G 3 G Sbjct: 97 G 97