BLASTX nr result
ID: Glycyrrhiza23_contig00029855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029855 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H-li... 70 2e-10 ref|XP_003548001.1| PREDICTED: V-type proton ATPase subunit H-li... 69 5e-10 ref|XP_003518060.1| PREDICTED: V-type proton ATPase subunit H-li... 69 5e-10 emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanth... 68 9e-10 gb|ABR17502.1| unknown [Picea sitchensis] 67 2e-09 >ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus] gi|449505987|ref|XP_004162622.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus] Length = 454 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 106 AELSTEQVLRRDIPWETYMSTKLISGTTLQLLRRY 2 AELSTEQVLRRDIPWETYM+TKLISGT+LQLLRRY Sbjct: 6 AELSTEQVLRRDIPWETYMTTKLISGTSLQLLRRY 40 >ref|XP_003548001.1| PREDICTED: V-type proton ATPase subunit H-like isoform 1 [Glycine max] gi|356559430|ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine max] Length = 452 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 115 MALAELSTEQVLRRDIPWETYMSTKLISGTTLQLLRRY 2 M AEL++EQVLRRDIPWETYMSTKLISGT+LQLLRRY Sbjct: 1 MDQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRY 38 >ref|XP_003518060.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max] Length = 452 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 115 MALAELSTEQVLRRDIPWETYMSTKLISGTTLQLLRRY 2 M AEL++EQVLRRDIPWETYMSTKLISGT+LQLLRRY Sbjct: 1 MYQAELTSEQVLRRDIPWETYMSTKLISGTSLQLLRRY 38 >emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanthemum crystallinum] Length = 470 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -2 Query: 106 AELSTEQVLRRDIPWETYMSTKLISGTTLQLLRRY 2 AELSTEQV++RDIPWETYM+TKLISGT+LQLLRRY Sbjct: 6 AELSTEQVMKRDIPWETYMTTKLISGTSLQLLRRY 40 >gb|ABR17502.1| unknown [Picea sitchensis] Length = 458 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 124 SNNMALAELSTEQVLRRDIPWETYMSTKLISGTTLQLLRRY 2 S N+ AEL+TEQVL+RDIPWETYM+ KLISGT LQLLRRY Sbjct: 3 SRNIDHAELTTEQVLKRDIPWETYMTAKLISGTCLQLLRRY 43