BLASTX nr result
ID: Glycyrrhiza23_contig00029662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029662 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34858.1| unknown [Lotus japonicus] 76 3e-12 gb|AFK39802.1| unknown [Medicago truncatula] 75 5e-12 ref|NP_001242331.1| uncharacterized protein LOC100810609 [Glycin... 70 2e-10 ref|XP_003603366.1| Adenine phosphoribosyltransferase [Medicago ... 69 3e-10 ref|XP_002308672.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 >gb|AFK34858.1| unknown [Lotus japonicus] Length = 191 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 218 ECACVIGVPEVKGQCRLIGKPLYVLVEPRQVDECF 114 ECACVIGVP+VKGQCRLIGKPLYVLVEPRQVD+CF Sbjct: 157 ECACVIGVPDVKGQCRLIGKPLYVLVEPRQVDKCF 191 >gb|AFK39802.1| unknown [Medicago truncatula] Length = 191 Score = 75.1 bits (183), Expect = 5e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 218 ECACVIGVPEVKGQCRLIGKPLYVLVEPRQVDECF 114 ECACVIGVPEVKG+C+L+GKPLYVLVEPRQVDECF Sbjct: 157 ECACVIGVPEVKGRCKLLGKPLYVLVEPRQVDECF 191 >ref|NP_001242331.1| uncharacterized protein LOC100810609 [Glycine max] gi|255642586|gb|ACU21556.1| unknown [Glycine max] Length = 193 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 218 ECACVIGVPEVKGQCRLIGKPLYVLVEPRQVDECF*D 108 ECACVIGVP+VKGQCR IGKPLYVLVEPR+ D+C+ D Sbjct: 157 ECACVIGVPDVKGQCRRIGKPLYVLVEPRKADKCYPD 193 >ref|XP_003603366.1| Adenine phosphoribosyltransferase [Medicago truncatula] gi|355492414|gb|AES73617.1| Adenine phosphoribosyltransferase [Medicago truncatula] Length = 194 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 218 ECACVIGVPEVKGQCRLIGKPLYVLVEPRQVDE 120 ECACVIGVPEVKG+C+L+GKPLYVLVEPRQVDE Sbjct: 157 ECACVIGVPEVKGRCKLLGKPLYVLVEPRQVDE 189 >ref|XP_002308672.1| predicted protein [Populus trichocarpa] gi|222854648|gb|EEE92195.1| predicted protein [Populus trichocarpa] Length = 191 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 218 ECACVIGVPEVKGQCRLIGKPLYVLVEPRQVDEC 117 ECACVIGVP++KGQCRL GKPLY+LVEPRQ+D C Sbjct: 157 ECACVIGVPDIKGQCRLNGKPLYILVEPRQIDNC 190