BLASTX nr result
ID: Glycyrrhiza23_contig00029558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029558 (664 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601377.1| hypothetical protein MTR_3g080060 [Medicago ... 57 3e-06 >ref|XP_003601377.1| hypothetical protein MTR_3g080060 [Medicago truncatula] gi|355490425|gb|AES71628.1| hypothetical protein MTR_3g080060 [Medicago truncatula] Length = 72 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 467 FHSFSNSPISSRGRVFKPEKRKVPTGSNPLHNKR 366 FH ++NSPISSRG+ F+ +KR+VPTG+NPLHNK+ Sbjct: 39 FHRWANSPISSRGKEFESQKRRVPTGANPLHNKK 72