BLASTX nr result
ID: Glycyrrhiza23_contig00029515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029515 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605830.1| hypothetical protein MTR_4g043420 [Medicago ... 70 2e-10 >ref|XP_003605830.1| hypothetical protein MTR_4g043420 [Medicago truncatula] gi|355506885|gb|AES88027.1| hypothetical protein MTR_4g043420 [Medicago truncatula] Length = 98 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = -3 Query: 308 DVFYGNDDHEEMNDYMYKEDVVESMRSEQRHKALRRRQKNKNKYC-RSLFQCFEFLWVLL 132 DVFYGNDD EEMN+ +YK+DV+ SMR + KAL++ K + K C F+CF LW LL Sbjct: 31 DVFYGNDDCEEMNECIYKDDVLVSMRRARELKALKKNNKKQKKNCYLKYFECFRCLWFLL 90 Query: 131 QC 126 C Sbjct: 91 GC 92