BLASTX nr result
ID: Glycyrrhiza23_contig00029436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029436 (429 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597616.1| hypothetical protein MTR_2g100200 [Medicago ... 123 1e-26 ref|XP_003547276.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 118 4e-25 ref|XP_002510695.1| pentatricopeptide repeat-containing protein,... 114 1e-23 ref|NP_199195.4| pentatricopeptide repeat-containing protein [Ar... 110 2e-22 ref|XP_002307761.1| predicted protein [Populus trichocarpa] gi|2... 108 5e-22 >ref|XP_003597616.1| hypothetical protein MTR_2g100200 [Medicago truncatula] gi|124360397|gb|ABN08410.1| Pentatricopeptide repeat [Medicago truncatula] gi|355486664|gb|AES67867.1| hypothetical protein MTR_2g100200 [Medicago truncatula] Length = 527 Score = 123 bits (309), Expect = 1e-26 Identities = 59/65 (90%), Positives = 62/65 (95%) Frame = +1 Query: 1 ENAVLVMEEALHKGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRY 180 ENAVLVMEEAL KGFCPSRLVYSKLSNKLLASN TERAY+LFLKIKHARSL+NAR+YWR Sbjct: 463 ENAVLVMEEALRKGFCPSRLVYSKLSNKLLASNLTERAYRLFLKIKHARSLKNARSYWRD 522 Query: 181 NGWHF 195 NGWHF Sbjct: 523 NGWHF 527 >ref|XP_003547276.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g43820-like [Glycine max] Length = 505 Score = 118 bits (296), Expect = 4e-25 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = +1 Query: 1 ENAVLVMEEALHKGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRY 180 ENAVLVMEEAL KGFCPSRLVYSKLSN+LLAS+++ERAYKLFLKIK ARSLENA+ YWR Sbjct: 441 ENAVLVMEEALRKGFCPSRLVYSKLSNRLLASDKSERAYKLFLKIKXARSLENAKKYWRS 500 Query: 181 NGWHF 195 NGWHF Sbjct: 501 NGWHF 505 >ref|XP_002510695.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551396|gb|EEF52882.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 195 Score = 114 bits (284), Expect = 1e-23 Identities = 51/65 (78%), Positives = 60/65 (92%) Frame = +1 Query: 1 ENAVLVMEEALHKGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRY 180 ENAVLVMEE+LHKGFCPSRL+YSKL+NKLLAS++ ERAYKL+LK++ ARS ENAR +WR Sbjct: 131 ENAVLVMEESLHKGFCPSRLIYSKLNNKLLASSKVERAYKLYLKVRDARSNENARRFWRA 190 Query: 181 NGWHF 195 NGWHF Sbjct: 191 NGWHF 195 >ref|NP_199195.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635652|sp|P0C8R0.1|PP416_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g43820 gi|332007631|gb|AED95014.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 546 Score = 110 bits (274), Expect = 2e-22 Identities = 50/65 (76%), Positives = 59/65 (90%) Frame = +1 Query: 1 ENAVLVMEEALHKGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRY 180 ENAVLVMEEA+ KGFCP+R VYS+LS+KL+ASN+TE AYKLFLKIK AR+ ENAR++WR Sbjct: 482 ENAVLVMEEAMRKGFCPNRFVYSRLSSKLMASNKTELAYKLFLKIKKARATENARSFWRS 541 Query: 181 NGWHF 195 NGWHF Sbjct: 542 NGWHF 546 >ref|XP_002307761.1| predicted protein [Populus trichocarpa] gi|222857210|gb|EEE94757.1| predicted protein [Populus trichocarpa] Length = 563 Score = 108 bits (270), Expect = 5e-22 Identities = 50/65 (76%), Positives = 56/65 (86%) Frame = +1 Query: 1 ENAVLVMEEALHKGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRY 180 ENAVLVMEE++ KGFCPSR + SKL+NKLLASN+ ERAY+LFLKIKHAR ENAR WR Sbjct: 499 ENAVLVMEESMRKGFCPSRFICSKLNNKLLASNKVERAYRLFLKIKHARHSENARRCWRS 558 Query: 181 NGWHF 195 NGWHF Sbjct: 559 NGWHF 563