BLASTX nr result
ID: Glycyrrhiza23_contig00029371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029371 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529752.1| PREDICTED: flavonol synthase/flavanone 3-hyd... 57 3e-14 ref|XP_003533043.1| PREDICTED: S-norcoclaurine synthase 1-like [... 57 4e-14 ref|XP_003627031.1| 1-aminocyclopropane-1-carboxylate oxidase [M... 48 2e-11 ref|XP_002515973.1| conserved hypothetical protein [Ricinus comm... 44 4e-06 >ref|XP_003529752.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Glycine max] Length = 357 Score = 57.0 bits (136), Expect(2) = 3e-14 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 126 FASLCFQKDEALCDVVSNPMAKIGCFQLLNHGIPL 22 F SLCF D+AL DVVS+ +A++GCFQLLNHGIPL Sbjct: 64 FVSLCFHCDDALRDVVSDSLARLGCFQLLNHGIPL 98 Score = 45.8 bits (107), Expect(2) = 3e-14 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -3 Query: 211 LEASLRVLDLVLPDKIFSKQKYHETPPKV 125 LEASLRV DLVLPDKIF KQK E PP+V Sbjct: 34 LEASLRVPDLVLPDKIFPKQKQLEAPPEV 62 >ref|XP_003533043.1| PREDICTED: S-norcoclaurine synthase 1-like [Glycine max] Length = 358 Score = 57.4 bits (137), Expect(2) = 4e-14 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 126 FASLCFQKDEALCDVVSNPMAKIGCFQLLNHGIPL 22 F SLCF D+AL D+VS+ +A+IGCFQLLNHGIPL Sbjct: 64 FVSLCFHCDDALRDIVSDSLARIGCFQLLNHGIPL 98 Score = 45.1 bits (105), Expect(2) = 4e-14 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -3 Query: 211 LEASLRVLDLVLPDKIFSKQKYHETPPKV 125 LEASLRV DLVLPDKIF KQ + E PP+V Sbjct: 34 LEASLRVPDLVLPDKIFPKQNHLEAPPEV 62 >ref|XP_003627031.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula] gi|355521053|gb|AET01507.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula] Length = 369 Score = 48.1 bits (113), Expect(2) = 2e-11 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = -1 Query: 126 FASLCFQKDEALCDVVSNPMAKIGCFQLLNHGI 28 F +LCF +DE L DVV +A+ GCFQL+NHGI Sbjct: 64 FVALCFHEDEDLIDVVLESIARFGCFQLINHGI 96 Score = 45.1 bits (105), Expect(2) = 2e-11 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -3 Query: 211 LEASLRVLDLVLPDKIFSKQKYHETPPKV 125 LE SLRV DLVLPDKIF KQ ETPPKV Sbjct: 34 LETSLRVPDLVLPDKIFPKQINDETPPKV 62 >ref|XP_002515973.1| conserved hypothetical protein [Ricinus communis] gi|223544878|gb|EEF46393.1| conserved hypothetical protein [Ricinus communis] Length = 303 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 211 LEASLRVLDLVLPDKIFSKQKYHETPPKV 125 LE SLRV DLVLPDKIF +QK ETPP++ Sbjct: 43 LEHSLRVPDLVLPDKIFPRQKILETPPRI 71 Score = 31.2 bits (69), Expect(2) = 4e-06 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 126 FASLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 25 F SL D + + +++IGCFQL+N+G+P Sbjct: 73 FQSLNSATDSDSIPKILDSLSRIGCFQLVNYGVP 106