BLASTX nr result
ID: Glycyrrhiza23_contig00029158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029158 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529235.1| PREDICTED: probable xyloglucan endotransgluc... 106 2e-21 gb|ACU21166.1| unknown [Glycine max] 106 2e-21 gb|AFK43337.1| unknown [Lotus japonicus] 104 7e-21 ref|XP_003555818.1| PREDICTED: probable xyloglucan endotransgluc... 102 3e-20 gb|AFK33963.1| unknown [Medicago truncatula] 100 2e-19 >ref|XP_003529235.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like [Glycine max] Length = 338 Score = 106 bits (264), Expect = 2e-21 Identities = 49/56 (87%), Positives = 53/56 (94%), Gaps = 1/56 (1%) Frame = +2 Query: 209 ASGSPR-NLPIVAFEEGYTPLFGDHNLVIHRDGKTVHLSLDERTGSGFASHDLYLH 373 +SGSPR NLPI+AFE+GYTPLFGDHNL IHRDGK+VHLSLDERTGSGF SHDLYLH Sbjct: 22 SSGSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLH 77 >gb|ACU21166.1| unknown [Glycine max] Length = 95 Score = 106 bits (264), Expect = 2e-21 Identities = 49/56 (87%), Positives = 53/56 (94%), Gaps = 1/56 (1%) Frame = +2 Query: 209 ASGSPR-NLPIVAFEEGYTPLFGDHNLVIHRDGKTVHLSLDERTGSGFASHDLYLH 373 +SGSPR NLPI+AFE+GYTPLFGDHNL IHRDGK+VHLSLDERTGSGF SHDLYLH Sbjct: 22 SSGSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLH 77 >gb|AFK43337.1| unknown [Lotus japonicus] Length = 292 Score = 104 bits (260), Expect = 7e-21 Identities = 49/70 (70%), Positives = 55/70 (78%) Frame = +2 Query: 164 GNMGXXXXXXXXXXXASGSPRNLPIVAFEEGYTPLFGDHNLVIHRDGKTVHLSLDERTGS 343 G+MG +SGS RNLPI+AFEEGYT LFGD+NL+IH DGK+VHLSLDERTGS Sbjct: 4 GHMGFMFCFSLLLVLSSGSSRNLPIIAFEEGYTHLFGDNNLIIHEDGKSVHLSLDERTGS 63 Query: 344 GFASHDLYLH 373 GF SHDLYLH Sbjct: 64 GFVSHDLYLH 73 >ref|XP_003555818.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 28-like [Glycine max] Length = 343 Score = 102 bits (255), Expect = 3e-20 Identities = 48/56 (85%), Positives = 52/56 (92%), Gaps = 1/56 (1%) Frame = +2 Query: 209 ASGSPR-NLPIVAFEEGYTPLFGDHNLVIHRDGKTVHLSLDERTGSGFASHDLYLH 373 +S SPR NLPI+AFE+GYTPLFGDHNL IHRDGK+VHLSLDERTGSGF SHDLYLH Sbjct: 27 SSVSPRRNLPIIAFEDGYTPLFGDHNLAIHRDGKSVHLSLDERTGSGFVSHDLYLH 82 >gb|AFK33963.1| unknown [Medicago truncatula] Length = 224 Score = 100 bits (248), Expect = 2e-19 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +2 Query: 209 ASGSPRNLPIVAFEEGYTPLFGDHNLVIHRDGKTVHLSLDERTGSGFASHDLYLH 373 AS S RNLPI AF+EGYTPLFGD+N+ +HRDGK+VHLSLDERTGSGF SHD+YLH Sbjct: 19 ASASSRNLPITAFDEGYTPLFGDNNVFVHRDGKSVHLSLDERTGSGFVSHDIYLH 73