BLASTX nr result
ID: Glycyrrhiza23_contig00029142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029142 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541442.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_003541442.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like [Glycine max] Length = 628 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/52 (55%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Frame = +2 Query: 248 MNGRTITRVVLPK--QHNRWLLHFSTSPSSCSSYDVGTCIASLQSCAHNTSL 397 MNGRT+ R V+PK QH+ FST YD+GTCIA+LQSCAHN +L Sbjct: 1 MNGRTLLRAVIPKPQQHHHHCRGFST-------YDLGTCIATLQSCAHNANL 45