BLASTX nr result
ID: Glycyrrhiza23_contig00029082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00029082 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550512.1| PREDICTED: two-component response regulator ... 84 1e-14 ref|XP_003529546.1| PREDICTED: two-component response regulator ... 84 1e-14 emb|CBL94183.1| putative type-b response regulator (sensor histi... 77 1e-12 ref|XP_002275142.2| PREDICTED: two-component response regulator ... 75 7e-12 emb|CBI22927.3| unnamed protein product [Vitis vinifera] 75 7e-12 >ref|XP_003550512.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 677 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 248 MNLSNGKGSLSTVTSSGTMKSGDAVSDRFPAGLRVLVVDDDPTCLM 385 MNLSNGKGS+ST+T+S MKSGDAVSD+FPAGLRVLVVDDDPTCLM Sbjct: 1 MNLSNGKGSMSTLTASVVMKSGDAVSDQFPAGLRVLVVDDDPTCLM 46 >ref|XP_003529546.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 679 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +2 Query: 248 MNLSNGKGSLSTVTSSGTMKSGDAVSDRFPAGLRVLVVDDDPTCLM 385 MNLSNGKGS+ST+T+S MKSGDAVSD+FPAGLRVLVVDDDPTCLM Sbjct: 1 MNLSNGKGSMSTLTASVVMKSGDAVSDQFPAGLRVLVVDDDPTCLM 46 >emb|CBL94183.1| putative type-b response regulator (sensor histidine kinase) [Malus x domestica] Length = 674 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +2 Query: 248 MNLSNGKGSLSTVTSSGTMKSGDAVSDRFPAGLRVLVVDDDPTCLM 385 M+LSNG GS+ST +SSG KSGD V+D+FPAGLRVLVVDDDPTCLM Sbjct: 1 MHLSNGMGSMSTASSSGAWKSGDVVTDQFPAGLRVLVVDDDPTCLM 46 >ref|XP_002275142.2| PREDICTED: two-component response regulator ARR1-like [Vitis vinifera] Length = 681 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 248 MNLSNGKGSLSTVTSSGTMKSGDAVSDRFPAGLRVLVVDDDPTCLM 385 MNL +G+GS+ST +SSG K+GD V D+FPAGLRVLVVDDDPTCLM Sbjct: 1 MNLGSGQGSMSTASSSGAWKAGDVVPDQFPAGLRVLVVDDDPTCLM 46 >emb|CBI22927.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +2 Query: 248 MNLSNGKGSLSTVTSSGTMKSGDAVSDRFPAGLRVLVVDDDPTCLM 385 MNL +G+GS+ST +SSG K+GD V D+FPAGLRVLVVDDDPTCLM Sbjct: 1 MNLGSGQGSMSTASSSGAWKAGDVVPDQFPAGLRVLVVDDDPTCLM 46