BLASTX nr result
ID: Glycyrrhiza23_contig00028836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028836 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536949.1| PREDICTED: leucine-rich repeat receptor-like... 87 2e-15 ref|XP_003520615.1| PREDICTED: leucine-rich repeat receptor-like... 85 7e-15 ref|XP_003553510.1| PREDICTED: leucine-rich repeat receptor-like... 84 2e-14 ref|XP_003625388.1| Receptor-like protein kinase [Medicago trunc... 78 9e-13 ref|XP_002535195.1| Receptor protein kinase CLAVATA1 precursor, ... 68 7e-10 >ref|XP_003536949.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like [Glycine max] Length = 1015 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +3 Query: 177 SYSFAAAANDEVSALLSIKAGLVDPLNTLQDWKLVHKALGNDAAHCNWTGV 329 SY +AAAANDEV+ALLSIK GL DPLN+L DWKLV KA G +AAHCNWTGV Sbjct: 18 SYGYAAAANDEVAALLSIKEGLTDPLNSLHDWKLVDKAEGKNAAHCNWTGV 68 >ref|XP_003520615.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like [Glycine max] Length = 1026 Score = 84.7 bits (208), Expect = 7e-15 Identities = 42/52 (80%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = +3 Query: 177 SYSFAAAA-NDEVSALLSIKAGLVDPLNTLQDWKLVHKALGNDAAHCNWTGV 329 SY FAAA+ NDEVSALLSIK GLVDPLN LQDWKL KA G DAAHCNWTG+ Sbjct: 23 SYGFAAASTNDEVSALLSIKEGLVDPLNALQDWKLHGKAPGTDAAHCNWTGI 74 >ref|XP_003553510.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like [Glycine max] Length = 1018 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = +3 Query: 177 SYSFAAAANDEVSALLSIKAGLVDPLNTLQDWKLVHKALGNDAAHCNWTGV 329 SY FAAA +EVSALLSIKAGLVDPLN LQDWKL K G DA+HCNWTG+ Sbjct: 17 SYGFAAAVTNEVSALLSIKAGLVDPLNALQDWKLHGKEPGQDASHCNWTGI 67 >ref|XP_003625388.1| Receptor-like protein kinase [Medicago truncatula] gi|355500403|gb|AES81606.1| Receptor-like protein kinase [Medicago truncatula] Length = 1024 Score = 77.8 bits (190), Expect = 9e-13 Identities = 38/51 (74%), Positives = 42/51 (82%) Frame = +3 Query: 177 SYSFAAAANDEVSALLSIKAGLVDPLNTLQDWKLVHKALGNDAAHCNWTGV 329 S SF+AA+NDEVSALLS+K GLVDPLNTLQDWKL DAAHCNWTG+ Sbjct: 27 SNSFSAASNDEVSALLSLKEGLVDPLNTLQDWKL-------DAAHCNWTGI 70 >ref|XP_002535195.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] gi|223523778|gb|EEF27188.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] Length = 1017 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +3 Query: 177 SYSFAAAANDEVSALLSIKAGLVDPLNTLQDWKLVHKALGNDAAHCNWTGV 329 ++S +AA N+EVS LLSIKA L+DPLN LQDWK L N +AHCNWTGV Sbjct: 24 AFSSSAALNEEVSVLLSIKASLLDPLNKLQDWK-----LSNTSAHCNWTGV 69