BLASTX nr result
ID: Glycyrrhiza23_contig00028781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028781 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554359.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 70 3e-10 ref|XP_003554358.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 70 3e-10 ref|XP_003543744.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 68 8e-10 ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 57 1e-06 gb|ACU24588.1| unknown [Glycine max] 57 1e-06 >ref|XP_003554359.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 2 [Glycine max] Length = 276 Score = 69.7 bits (169), Expect = 3e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -1 Query: 548 SIPEEERNGYEWLQERDQLDDLKVDGKMYSGPKIVES 438 SIPEEE+N YEWLQERD+L+DL+V+GKMY+GPKIVES Sbjct: 240 SIPEEEKNAYEWLQERDELEDLEVNGKMYNGPKIVES 276 >ref|XP_003554358.1| PREDICTED: 2-aminoethanethiol dioxygenase-like isoform 1 [Glycine max] Length = 281 Score = 69.7 bits (169), Expect = 3e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -1 Query: 548 SIPEEERNGYEWLQERDQLDDLKVDGKMYSGPKIVES 438 SIPEEE+N YEWLQERD+L+DL+V+GKMY+GPKIVES Sbjct: 245 SIPEEEKNAYEWLQERDELEDLEVNGKMYNGPKIVES 281 >ref|XP_003543744.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Length = 281 Score = 68.2 bits (165), Expect = 8e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -1 Query: 548 SIPEEERNGYEWLQERDQLDDLKVDGKMYSGPKIVES 438 SIPEEE+N YEWLQER++L+DL+V+GKMY+GPKIVES Sbjct: 245 SIPEEEKNAYEWLQEREELEDLEVNGKMYNGPKIVES 281 >ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Length = 288 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 548 SIPEEERNGYEWLQERDQLDDLKVDGKMYSGPKIVES 438 SIPEEER YEWLQE+++ ++LKV KMYSGPKIVE+ Sbjct: 252 SIPEEERTAYEWLQEKEKPENLKVVVKMYSGPKIVEN 288 >gb|ACU24588.1| unknown [Glycine max] Length = 287 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 548 SIPEEERNGYEWLQERDQLDDLKVDGKMYSGPKIVES 438 SIPEEER YEWLQE+++ ++LKV KMYSGPKIVE+ Sbjct: 251 SIPEEERTAYEWLQEKEKPENLKVVVKMYSGPKIVEN 287