BLASTX nr result
ID: Glycyrrhiza23_contig00028652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028652 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625044.1| Pentatricopeptide repeat-containing protein ... 172 3e-41 ref|XP_002530223.1| pentatricopeptide repeat-containing protein,... 160 1e-37 ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containi... 159 3e-37 ref|NP_194398.1| pentatricopeptide repeat-containing protein [Ar... 157 6e-37 ref|XP_002869597.1| pentatricopeptide repeat-containing protein ... 156 1e-36 >ref|XP_003625044.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500059|gb|AES81262.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 521 Score = 172 bits (435), Expect = 3e-41 Identities = 82/110 (74%), Positives = 93/110 (84%) Frame = +2 Query: 2 DAVLSLEFFNWVHTHNPSSHTLDTHSFLLHTLAKNRNFKTTQSILRRILATTTVDFPHKL 181 DAVLSL+FFNWV THNP+SHTL THSFLLH L KNRNFKT QSI +I+ T + L Sbjct: 81 DAVLSLKFFNWVQTHNPNSHTLHTHSFLLHILTKNRNFKTAQSIFSKIITTNS-----NL 135 Query: 182 FDALLHSYILCDSSPLVFDALFKTYAHMNKLRNATDTFLQMKEYGFFPTV 331 F++LLHSY LC+SSPLVFD LFKT+AHMNKLRNATDTF++MKEYGFFPTV Sbjct: 136 FESLLHSYTLCNSSPLVFDTLFKTFAHMNKLRNATDTFVKMKEYGFFPTV 185 >ref|XP_002530223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530270|gb|EEF32170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 160 bits (405), Expect = 1e-37 Identities = 75/110 (68%), Positives = 87/110 (79%) Frame = +2 Query: 2 DAVLSLEFFNWVHTHNPSSHTLDTHSFLLHTLAKNRNFKTTQSILRRILATTTVDFPHKL 181 D VLSLEFFNWV T NPSSHTL+THS +LH L KNR FK+ + IL+ +L +D P KL Sbjct: 72 DHVLSLEFFNWVQTENPSSHTLETHSMILHILTKNRKFKSAELILKSVLVKGFIDLPDKL 131 Query: 182 FDALLHSYILCDSSPLVFDALFKTYAHMNKLRNATDTFLQMKEYGFFPTV 331 F+A+L+SY +CDSSP VFD+LFKT AHM K RNATDTFLQMK YGF PTV Sbjct: 132 FEAILYSYRMCDSSPRVFDSLFKTLAHMKKFRNATDTFLQMKGYGFLPTV 181 >ref|XP_004140069.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] gi|449528063|ref|XP_004171026.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cucumis sativus] Length = 536 Score = 159 bits (401), Expect = 3e-37 Identities = 73/110 (66%), Positives = 89/110 (80%) Frame = +2 Query: 2 DAVLSLEFFNWVHTHNPSSHTLDTHSFLLHTLAKNRNFKTTQSILRRILATTTVDFPHKL 181 D VLSLEFFNWV T NPSSHTL+TH +LH L K R FK+ +SILR I+ + ++DFP KL Sbjct: 94 DYVLSLEFFNWVATQNPSSHTLETHCIILHILTKRRKFKSAESILRSIIESCSIDFPSKL 153 Query: 182 FDALLHSYILCDSSPLVFDALFKTYAHMNKLRNATDTFLQMKEYGFFPTV 331 F++LL+SY LCDSSP VFD LFKT+AH+ K RNA+DTF +MK+YGF PTV Sbjct: 154 FESLLYSYRLCDSSPHVFDLLFKTFAHLKKFRNASDTFCRMKDYGFLPTV 203 >ref|NP_194398.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186944|ref|NP_001190849.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213515|sp|Q9SZ10.1|PP338_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g26680, mitochondrial; Flags: Precursor gi|4455191|emb|CAB36514.1| putative protein [Arabidopsis thaliana] gi|7269520|emb|CAB79523.1| putative protein [Arabidopsis thaliana] gi|332659836|gb|AEE85236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659837|gb|AEE85237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 157 bits (398), Expect = 6e-37 Identities = 72/110 (65%), Positives = 88/110 (80%) Frame = +2 Query: 2 DAVLSLEFFNWVHTHNPSSHTLDTHSFLLHTLAKNRNFKTTQSILRRILATTTVDFPHKL 181 D +LSLEFFNW T NP SH+L+TH+ +LHTL KNR FK+ +SILR +L VD P K+ Sbjct: 94 DYLLSLEFFNWAKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDVLVNGGVDLPAKV 153 Query: 182 FDALLHSYILCDSSPLVFDALFKTYAHMNKLRNATDTFLQMKEYGFFPTV 331 FDALL+SY CDS+P VFD+LFKT+AH+ K RNATDTF+QMK+YGF PTV Sbjct: 154 FDALLYSYRECDSTPRVFDSLFKTFAHLKKFRNATDTFMQMKDYGFLPTV 203 >ref|XP_002869597.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315433|gb|EFH45856.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 538 Score = 156 bits (395), Expect = 1e-36 Identities = 71/110 (64%), Positives = 88/110 (80%) Frame = +2 Query: 2 DAVLSLEFFNWVHTHNPSSHTLDTHSFLLHTLAKNRNFKTTQSILRRILATTTVDFPHKL 181 D +LS EFFNW T NP+SH+L+TH+ +LHTL KNR FK+ +SILR +L VD P K+ Sbjct: 94 DYLLSFEFFNWAKTRNPASHSLETHAIVLHTLTKNRKFKSAESILRDVLVNGGVDLPAKV 153 Query: 182 FDALLHSYILCDSSPLVFDALFKTYAHMNKLRNATDTFLQMKEYGFFPTV 331 FDALL+SY CDS+P VFD+LFKT+AH+ K RNATDTF+QMK+YGF PTV Sbjct: 154 FDALLYSYRECDSTPRVFDSLFKTFAHLKKFRNATDTFMQMKDYGFLPTV 203