BLASTX nr result
ID: Glycyrrhiza23_contig00028621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028621 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547021.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_003542028.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 >ref|XP_003547021.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Glycine max] Length = 507 Score = 58.5 bits (140), Expect = 5e-07 Identities = 34/56 (60%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -3 Query: 167 MWSLRGI-VQAKFVESIRRTTCGIETRLSLRLLCTQTTQNLDSLCRRIEKLPKGES 3 M S+ GI Q + V+ I RT CGI + L+L CTQ TQN DSL RRIEKLPKGES Sbjct: 1 MRSVIGIFAQQRLVQLIHRTPCGI---VCLKLFCTQATQNHDSLSRRIEKLPKGES 53 >ref|XP_003542028.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Glycine max] Length = 507 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 143 QAKFVESIRRTTCGIETRLSLRLLCTQTTQNLDSLCRRIEKLPKGES 3 Q + V+ IRRT C I +SL+L CTQ TQN DSL RRIE+LPKGES Sbjct: 10 QQRLVQLIRRTPCDI---ISLKLFCTQATQNHDSLSRRIERLPKGES 53