BLASTX nr result
ID: Glycyrrhiza23_contig00028575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028575 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635903.1| Ankyrin repeat containing protein [Medicago ... 65 4e-09 >ref|XP_003635903.1| Ankyrin repeat containing protein [Medicago truncatula] gi|355501838|gb|AES83041.1| Ankyrin repeat containing protein [Medicago truncatula] Length = 336 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 271 AVKKGLWNEAKSIIGRGGDVIFQKSSSNGWTVLHVAVDAGRDR 143 AVKKG+WN+A I R GD+I QKSS NGWT LHVAVDAG+D+ Sbjct: 144 AVKKGMWNDAIFFIRRDGDIISQKSSFNGWTSLHVAVDAGQDK 186