BLASTX nr result
ID: Glycyrrhiza23_contig00028557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028557 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containi... 148 4e-34 ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containi... 148 5e-34 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 148 5e-34 ref|XP_003603234.1| Pentatricopeptide repeat-containing protein ... 147 7e-34 ref|NP_195043.1| pentatricopeptide repeat-containing protein [Ar... 147 1e-33 >ref|XP_003523656.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1611 Score = 148 bits (374), Expect = 4e-34 Identities = 67/76 (88%), Positives = 73/76 (96%) Frame = +1 Query: 1 KESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIKYISKVFQREIVLRDAN 180 KE +LY+HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCH+AIKYISKVF+REIVLRDAN Sbjct: 1536 KECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHSAIKYISKVFKREIVLRDAN 1595 Query: 181 RFHRFRNGICSCGDYW 228 RFH FRNGICSCGDYW Sbjct: 1596 RFHHFRNGICSCGDYW 1611 >ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1582 Score = 148 bits (373), Expect = 5e-34 Identities = 65/76 (85%), Positives = 73/76 (96%) Frame = +1 Query: 1 KESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIKYISKVFQREIVLRDAN 180 KE +LY+HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCHNAIKYISKVF+RE+VLRDAN Sbjct: 1507 KECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHNAIKYISKVFEREVVLRDAN 1566 Query: 181 RFHRFRNGICSCGDYW 228 RFH FR+G+CSCGDYW Sbjct: 1567 RFHHFRSGVCSCGDYW 1582 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 148 bits (373), Expect = 5e-34 Identities = 65/76 (85%), Positives = 73/76 (96%) Frame = +1 Query: 1 KESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIKYISKVFQREIVLRDAN 180 KE ALY+HSEKLA+A+GL+ TPPSTPIRVIKNLRVCGDCHNA+KYISKV+ REIVLRDAN Sbjct: 922 KERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMKYISKVYDREIVLRDAN 981 Query: 181 RFHRFRNGICSCGDYW 228 RFHRF++GICSCGDYW Sbjct: 982 RFHRFKDGICSCGDYW 997 >ref|XP_003603234.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355492282|gb|AES73485.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 973 Score = 147 bits (372), Expect = 7e-34 Identities = 68/76 (89%), Positives = 72/76 (94%) Frame = +1 Query: 1 KESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIKYISKVFQREIVLRDAN 180 KESAL +HSEKLAIAYGL+KTPPST +RVIKNLRVCGDCHNAIKYIS VFQREIVLRDAN Sbjct: 898 KESALSYHSEKLAIAYGLMKTPPSTTLRVIKNLRVCGDCHNAIKYISNVFQREIVLRDAN 957 Query: 181 RFHRFRNGICSCGDYW 228 RFH FR+GICSCGDYW Sbjct: 958 RFHHFRSGICSCGDYW 973 >ref|NP_195043.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206840|sp|Q9SMZ2.1|PP347_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33170 gi|4455331|emb|CAB36791.1| putative protein [Arabidopsis thaliana] gi|7270265|emb|CAB80034.1| putative protein [Arabidopsis thaliana] gi|332660786|gb|AEE86186.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 990 Score = 147 bits (370), Expect = 1e-33 Identities = 64/76 (84%), Positives = 73/76 (96%) Frame = +1 Query: 1 KESALYHHSEKLAIAYGLIKTPPSTPIRVIKNLRVCGDCHNAIKYISKVFQREIVLRDAN 180 KE ALY+HSEKLA+A+GL+ TPPSTPIRVIKNLRVCGDCHNA+KYI+KV+ REIVLRDAN Sbjct: 915 KERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVCGDCHNAMKYIAKVYNREIVLRDAN 974 Query: 181 RFHRFRNGICSCGDYW 228 RFHRF++GICSCGDYW Sbjct: 975 RFHRFKDGICSCGDYW 990