BLASTX nr result
ID: Glycyrrhiza23_contig00028263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028263 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551780.1| PREDICTED: DUF246 domain-containing protein ... 83 3e-14 ref|XP_003530456.1| PREDICTED: DUF246 domain-containing protein ... 67 2e-09 ref|XP_003554945.1| PREDICTED: DUF246 domain-containing protein ... 64 1e-08 ref|XP_002267425.2| PREDICTED: DUF246 domain-containing protein ... 57 2e-06 emb|CBI15357.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_003551780.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 505 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = +2 Query: 206 EGMGMELKVLSANKIEKHKRFIIRPRIKVWMARAITTVVLWTSVVQLIAMG 358 +G+ MELKVL+ +K+EKH+ FIIRPRIKVWMARAIT VVLWTS+VQLIA+G Sbjct: 14 KGIKMELKVLATDKVEKHESFIIRPRIKVWMARAITFVVLWTSLVQLIALG 64 >ref|XP_003530456.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 499 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = +2 Query: 203 CEGMGMELKVLSANKIEKHKRFIIRPRIKVWMARAITTVVLWTSVVQLIAMG 358 C+ G+++++ K+EKH+ IIRPRIK+WMARAIT V+LWTS+VQLIA+G Sbjct: 11 CDTKGIKMEL----KVEKHETLIIRPRIKMWMARAITIVLLWTSLVQLIALG 58 >ref|XP_003554945.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 508 Score = 63.9 bits (154), Expect = 1e-08 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = +2 Query: 179 MEEATSEACEGMGMEL--KVLSA-NKIEKHKRFIIRPRIKVWMARAITTVVLWTSVVQLI 349 M + + C+ ME+ VL ++I K KR I+RP IKVWMARAITTV+LWT VVQL+ Sbjct: 1 MSDGKGDHCDSEEMEMGFNVLGGGDEIVKSKRLIVRPGIKVWMARAITTVILWTCVVQLM 60 Query: 350 AMG 358 A+G Sbjct: 61 AIG 63 >ref|XP_002267425.2| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 678 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = +2 Query: 137 NQWFC*DGEKKRTLMEEATSEACEGMGMELKVLSANKIEKHKRFII--RPRIKVWMARAI 310 N W GEK E + + +GM LK LSA+++EK K ++ R R+K+WM RA Sbjct: 157 NAW----GEKIGMCRLERSEKKGVVIGMGLKALSASRVEKLKSSMVTSRSRMKLWMIRAT 212 Query: 311 TTVVLWTSVVQLIAMG 358 T+V+LWT +VQL A+G Sbjct: 213 TSVLLWTCIVQLTALG 228 >emb|CBI15357.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/51 (52%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = +2 Query: 212 MGMELKVLSANKIEKHKRFII--RPRIKVWMARAITTVVLWTSVVQLIAMG 358 +GM LK LSA+++EK K ++ R R+K+WM RA T+V+LWT +VQL A+G Sbjct: 14 IGMGLKALSASRVEKLKSSMVTSRSRMKLWMIRATTSVLLWTCIVQLTALG 64