BLASTX nr result
ID: Glycyrrhiza23_contig00028240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028240 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588521.1| Pectinesterase [Medicago truncatula] gi|3554... 55 8e-06 ref|XP_003522542.1| PREDICTED: probable pectinesterase/pectinest... 53 8e-06 >ref|XP_003588521.1| Pectinesterase [Medicago truncatula] gi|355477569|gb|AES58772.1| Pectinesterase [Medicago truncatula] Length = 609 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 119 QDTCTEGFADTSGAIKDQMAANHKDLSEMVANNL 220 QDTC EGF DTSG +KDQM N KDLSE+V+N+L Sbjct: 207 QDTCLEGFEDTSGTVKDQMVGNLKDLSELVSNSL 240 >ref|XP_003522542.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61-like [Glycine max] Length = 636 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 119 QDTCTEGFADTSGAIKDQMAANHKDLSEMVANNL 220 QDTC EGFAD +G +KDQMA N KDLSE+V+N L Sbjct: 235 QDTCAEGFADAAGTVKDQMANNLKDLSELVSNCL 268 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 228 AGDDFSDVPI 257 AGDDF+ VPI Sbjct: 276 AGDDFAGVPI 285