BLASTX nr result
ID: Glycyrrhiza23_contig00028147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00028147 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633077.1| PREDICTED: actin-related protein 6 isoform 2... 67 2e-09 ref|XP_003525911.1| PREDICTED: LOW QUALITY PROTEIN: actin-relate... 67 2e-09 ref|XP_003522641.1| PREDICTED: actin-related protein 6-like isof... 67 2e-09 ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isof... 67 2e-09 ref|XP_002285295.1| PREDICTED: actin-related protein 6 isoform 1... 67 2e-09 >ref|XP_003633077.1| PREDICTED: actin-related protein 6 isoform 2 [Vitis vinifera] Length = 385 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLASSPHFEAMCVTKSEYEELGSARCRKRFFH 96 LLASSP FEAMCVTKSEYEELGSARCRKRFFH Sbjct: 354 LLASSPDFEAMCVTKSEYEELGSARCRKRFFH 385 >ref|XP_003525911.1| PREDICTED: LOW QUALITY PROTEIN: actin-related protein 6-like [Glycine max] Length = 348 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLASSPHFEAMCVTKSEYEELGSARCRKRFFH 96 LLASSP FEAMCVTKSEYEELGSARCRKRFFH Sbjct: 317 LLASSPDFEAMCVTKSEYEELGSARCRKRFFH 348 >ref|XP_003522641.1| PREDICTED: actin-related protein 6-like isoform 2 [Glycine max] Length = 434 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLASSPHFEAMCVTKSEYEELGSARCRKRFFH 96 LLASSP FEAMCVTKSEYEELGSARCRKRFFH Sbjct: 403 LLASSPDFEAMCVTKSEYEELGSARCRKRFFH 434 >ref|XP_003522640.1| PREDICTED: actin-related protein 6-like isoform 1 [Glycine max] Length = 436 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLASSPHFEAMCVTKSEYEELGSARCRKRFFH 96 LLASSP FEAMCVTKSEYEELGSARCRKRFFH Sbjct: 405 LLASSPDFEAMCVTKSEYEELGSARCRKRFFH 436 >ref|XP_002285295.1| PREDICTED: actin-related protein 6 isoform 1 [Vitis vinifera] gi|297738970|emb|CBI28215.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +1 Query: 1 LLASSPHFEAMCVTKSEYEELGSARCRKRFFH 96 LLASSP FEAMCVTKSEYEELGSARCRKRFFH Sbjct: 402 LLASSPDFEAMCVTKSEYEELGSARCRKRFFH 433