BLASTX nr result
ID: Glycyrrhiza23_contig00027879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027879 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532585.1| PREDICTED: glutamyl-tRNA reductase 1, chloro... 96 2e-18 ref|XP_003528406.1| PREDICTED: glutamyl-tRNA reductase 1, chloro... 94 1e-17 ref|XP_003608341.1| Glutamyl-tRNA reductase [Medicago truncatula... 89 5e-16 ref|XP_002264428.1| PREDICTED: glutamyl-tRNA reductase 1, chloro... 82 3e-14 ref|XP_003526522.1| PREDICTED: glutamyl-tRNA reductase 1, chloro... 82 5e-14 >ref|XP_003532585.1| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max] Length = 535 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 449 VNKLLHGPMQHLRCDGNHDHSLSEVLENMRALNRMYDLETDTSLVDEKIRV 297 VNKLLHGPMQHLRCDG +D SLSEVLENMRALNRMYDLET+TSL++EKIRV Sbjct: 478 VNKLLHGPMQHLRCDGKNDSSLSEVLENMRALNRMYDLETETSLIEEKIRV 528 >ref|XP_003528406.1| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max] Length = 533 Score = 94.0 bits (232), Expect = 1e-17 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -3 Query: 449 VNKLLHGPMQHLRCDGNHDHSLSEVLENMRALNRMYDLETDTSLVDEKIRV 297 VNKLLHGPMQHLRCDG +D SLSEVLENMRALNRMYDLET+ SL++EKIRV Sbjct: 476 VNKLLHGPMQHLRCDGKNDSSLSEVLENMRALNRMYDLETEISLIEEKIRV 526 >ref|XP_003608341.1| Glutamyl-tRNA reductase [Medicago truncatula] gi|355509396|gb|AES90538.1| Glutamyl-tRNA reductase [Medicago truncatula] Length = 529 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -3 Query: 449 VNKLLHGPMQHLRCDGNHDHSLSEVLENMRALNRMYDLETDTSLVDEKIRV 297 VNKLLHGPMQHLRCDGN L EVLENMRALNRMYDLET+ SL++EKIRV Sbjct: 472 VNKLLHGPMQHLRCDGNDTKCLDEVLENMRALNRMYDLETEISLMEEKIRV 522 >ref|XP_002264428.1| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic [Vitis vinifera] gi|296088095|emb|CBI35454.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -3 Query: 449 VNKLLHGPMQHLRCDGNHDHSLSEVLENMRALNRMYDLETDTSLVDEKIR 300 VNKLLHGP+QHLRCD N + +L+E LENM ALNR++DLETDTSL++EKIR Sbjct: 475 VNKLLHGPIQHLRCDENENRTLNETLENMHALNRIFDLETDTSLLEEKIR 524 >ref|XP_003526522.1| PREDICTED: glutamyl-tRNA reductase 1, chloroplastic-like [Glycine max] Length = 536 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -3 Query: 449 VNKLLHGPMQHLRCDGNHDHSLSEVLENMRALNRMYDLETDTSLVDEKIR 300 VNKLLHGPMQHLRCDGN +LSE LENM ALNRM++LET+ S+++EKIR Sbjct: 479 VNKLLHGPMQHLRCDGNDSRTLSETLENMHALNRMFNLETEISVLEEKIR 528