BLASTX nr result
ID: Glycyrrhiza23_contig00027868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027868 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago ... 88 6e-16 ref|XP_003628428.1| Leucine-rich repeat family protein /protein ... 86 3e-15 ref|XP_002524511.1| ATP binding protein, putative [Ricinus commu... 79 3e-13 ref|XP_003539626.1| PREDICTED: probable leucine-rich repeat rece... 79 5e-13 ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [... 76 3e-12 >ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago truncatula] gi|355522454|gb|AET02908.1| hypothetical protein MTR_8g058070 [Medicago truncatula] Length = 117 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 1/54 (1%) Frame = +1 Query: 67 GATLQQDEVEALKDIGKVLGK-NWDFSVDPCSGRNNWVAPQSQGGFQNAVTCDC 225 GATLQ+DEVEALKDIGK LGK +WDFSVDPCSGRNNW++ G +NAVTC+C Sbjct: 25 GATLQEDEVEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNC 78 >ref|XP_003628428.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355522450|gb|AET02904.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 116 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/53 (73%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +1 Query: 70 ATLQQDEVEALKDIGKVLGK-NWDFSVDPCSGRNNWVAPQSQGGFQNAVTCDC 225 ATLQ+DEVEALKDIGK LGK +WDFSVDPCSGRNNW++ G +NAVTC+C Sbjct: 26 ATLQEDEVEALKDIGKTLGKKDWDFSVDPCSGRNNWISSTQLHGSENAVTCNC 78 >ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis] gi|223536185|gb|EEF37838.1| ATP binding protein, putative [Ricinus communis] Length = 985 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 70 ATLQQDEVEALKDIGKVLGKNWDFSVDPCSGRNNWVAPQSQGGFQNAVTCDC 225 A L DEVEALKDIGK LGK W+F+VDPCSG + W P GF+NAVTC+C Sbjct: 25 ARLPNDEVEALKDIGKTLGKTWNFTVDPCSGDSGWTTPNPVKGFENAVTCNC 76 >ref|XP_003539626.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Glycine max] Length = 1111 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/54 (64%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = +1 Query: 67 GATLQQDEVEALKDIGKVLGK-NWDFSVDPCSGRNNWVAPQSQGGFQNAVTCDC 225 GATL +DEV+ +KDIG+ LGK NWDFSVDPCSG++NW + GF+NAVTC C Sbjct: 132 GATLPEDEVQVMKDIGRTLGKKNWDFSVDPCSGQSNWTSFVQVKGFENAVTCIC 185 >ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355518088|gb|AES99711.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 996 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +1 Query: 67 GATLQQDEVEALKDIGKVLGK-NWDFSVDPCSGRNNWVAPQSQGGFQNAVTCDC 225 GATL +DEVE LKDI K LGK +WDFSVDPCSG NW + G +NAVTC+C Sbjct: 25 GATLSKDEVEVLKDIAKTLGKKDWDFSVDPCSGERNWTSSVQVKGSENAVTCNC 78