BLASTX nr result
ID: Glycyrrhiza23_contig00027829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027829 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552368.1| PREDICTED: SPX and EXS domain-containing pro... 166 2e-39 ref|XP_003533623.1| PREDICTED: SPX and EXS domain-containing pro... 166 2e-39 ref|XP_003623873.1| SPX and EXS domain-containing protein [Medic... 153 1e-35 ref|NP_568530.1| EXS (ERD1/XPR1/SYG1) domain protein [Arabidopsi... 139 2e-31 dbj|BAB09270.1| unnamed protein product [Arabidopsis thaliana] 139 2e-31 >ref|XP_003552368.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Glycine max] Length = 420 Score = 166 bits (419), Expect = 2e-39 Identities = 78/84 (92%), Positives = 80/84 (95%) Frame = -1 Query: 333 WVYFWVIGSNFILRCSWTYKLSAHLRHNYLTVFTITLLEMLRRFQWVFFRVENEWNKITR 154 WVYFWVIGSNF+LRCSWTYKLSAHLRHNYLTVFTITLLEM RRFQWVFFRVENEWNKITR Sbjct: 338 WVYFWVIGSNFVLRCSWTYKLSAHLRHNYLTVFTITLLEMFRRFQWVFFRVENEWNKITR 397 Query: 153 SGVQLTEVQREEEKLLGSNNIHGV 82 SGVQLTE+ REEEKLLGS NIH V Sbjct: 398 SGVQLTEIPREEEKLLGS-NIHDV 420 >ref|XP_003533623.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Glycine max] Length = 420 Score = 166 bits (419), Expect = 2e-39 Identities = 78/84 (92%), Positives = 80/84 (95%) Frame = -1 Query: 333 WVYFWVIGSNFILRCSWTYKLSAHLRHNYLTVFTITLLEMLRRFQWVFFRVENEWNKITR 154 WVYFWVIGSNF+LRCSWTYKLSAHLRHNYLTVFTITLLEM RRFQWVFFRVENEWNKITR Sbjct: 338 WVYFWVIGSNFVLRCSWTYKLSAHLRHNYLTVFTITLLEMFRRFQWVFFRVENEWNKITR 397 Query: 153 SGVQLTEVQREEEKLLGSNNIHGV 82 SGVQLTE+ REEEKLLGS NIH V Sbjct: 398 SGVQLTEIPREEEKLLGS-NIHDV 420 >ref|XP_003623873.1| SPX and EXS domain-containing protein [Medicago truncatula] gi|355498888|gb|AES80091.1| SPX and EXS domain-containing protein [Medicago truncatula] Length = 430 Score = 153 bits (387), Expect = 1e-35 Identities = 74/84 (88%), Positives = 76/84 (90%) Frame = -1 Query: 333 WVYFWVIGSNFILRCSWTYKLSAHLRHNYLTVFTITLLEMLRRFQWVFFRVENEWNKITR 154 WVYFWVIGSN ILR SWTYKLSAHLRHNYLTVF ITLLEM RRFQWVFFRVENEWNKITR Sbjct: 348 WVYFWVIGSNLILRGSWTYKLSAHLRHNYLTVFGITLLEMFRRFQWVFFRVENEWNKITR 407 Query: 153 SGVQLTEVQREEEKLLGSNNIHGV 82 SGVQL E+ REEEKLLG+ NIH V Sbjct: 408 SGVQLAEIPREEEKLLGT-NIHDV 430 >ref|NP_568530.1| EXS (ERD1/XPR1/SYG1) domain protein [Arabidopsis thaliana] gi|17979075|gb|AAL49805.1| unknown protein [Arabidopsis thaliana] gi|21554193|gb|AAM63272.1| unknown [Arabidopsis thaliana] gi|25055013|gb|AAN71970.1| unknown protein [Arabidopsis thaliana] gi|332006626|gb|AED94009.1| EXS (ERD1/XPR1/SYG1) domain protein [Arabidopsis thaliana] Length = 457 Score = 139 bits (350), Expect = 2e-31 Identities = 63/84 (75%), Positives = 72/84 (85%) Frame = -1 Query: 333 WVYFWVIGSNFILRCSWTYKLSAHLRHNYLTVFTITLLEMLRRFQWVFFRVENEWNKITR 154 WVYFWVIGSN +LRC+WTYKLSAHLRHNY+TVFT+T +EMLRRFQWVFFRVENEWNKIT+ Sbjct: 375 WVYFWVIGSNLVLRCAWTYKLSAHLRHNYITVFTMTAMEMLRRFQWVFFRVENEWNKITK 434 Query: 153 SGVQLTEVQREEEKLLGSNNIHGV 82 S + E+ EE+KLLGS H V Sbjct: 435 SH-PMGEISLEEDKLLGSTTPHDV 457 >dbj|BAB09270.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 139 bits (350), Expect = 2e-31 Identities = 63/84 (75%), Positives = 72/84 (85%) Frame = -1 Query: 333 WVYFWVIGSNFILRCSWTYKLSAHLRHNYLTVFTITLLEMLRRFQWVFFRVENEWNKITR 154 WVYFWVIGSN +LRC+WTYKLSAHLRHNY+TVFT+T +EMLRRFQWVFFRVENEWNKIT+ Sbjct: 204 WVYFWVIGSNLVLRCAWTYKLSAHLRHNYITVFTMTAMEMLRRFQWVFFRVENEWNKITK 263 Query: 153 SGVQLTEVQREEEKLLGSNNIHGV 82 S + E+ EE+KLLGS H V Sbjct: 264 SH-PMGEISLEEDKLLGSTTPHDV 286