BLASTX nr result
ID: Glycyrrhiza23_contig00027604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027604 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602564.1| U-box domain-containing protein [Medicago tr... 120 1e-25 ref|XP_003531405.1| PREDICTED: U-box domain-containing protein 2... 119 3e-25 ref|XP_003525112.1| PREDICTED: U-box domain-containing protein 2... 119 3e-25 ref|XP_003630199.1| U-box domain-containing protein [Medicago tr... 119 3e-25 ref|XP_002517222.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 114 8e-24 >ref|XP_003602564.1| U-box domain-containing protein [Medicago truncatula] gi|355491612|gb|AES72815.1| U-box domain-containing protein [Medicago truncatula] Length = 419 Score = 120 bits (301), Expect = 1e-25 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 LWSVCYLFRDEKAREAVAEANGLTKILLLMQSSNCSPQVRLMCTDLLKVFRVNSKSILSS 180 LWSVCYLFRD+KA+EAV ANGLTKILLL+QS NCSPQVR MCTDLLK+FRVNSKS LSS Sbjct: 350 LWSVCYLFRDQKAQEAVTMANGLTKILLLIQS-NCSPQVRQMCTDLLKIFRVNSKSCLSS 408 Query: 181 YNTKTTHIVPF 213 Y+TKT+HI+PF Sbjct: 409 YDTKTSHIMPF 419 >ref|XP_003531405.1| PREDICTED: U-box domain-containing protein 27-like [Glycine max] Length = 418 Score = 119 bits (298), Expect = 3e-25 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 LWSVCYLFRDEKAREAVAEANGLTKILLLMQSSNCSPQVRLMCTDLLKVFRVNSKSILSS 180 LWSVCYLFRD+KA+EAV +ANGLTKILLLMQS NCSPQVR M +DLLK+FRVNSKS LSS Sbjct: 349 LWSVCYLFRDQKAQEAVTKANGLTKILLLMQS-NCSPQVRQMSSDLLKIFRVNSKSCLSS 407 Query: 181 YNTKTTHIVPF 213 Y+TKTTHI+PF Sbjct: 408 YDTKTTHIMPF 418 >ref|XP_003525112.1| PREDICTED: U-box domain-containing protein 27-like [Glycine max] Length = 418 Score = 119 bits (298), Expect = 3e-25 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +1 Query: 1 LWSVCYLFRDEKAREAVAEANGLTKILLLMQSSNCSPQVRLMCTDLLKVFRVNSKSILSS 180 LWSVCYLFRD+KA+EAV +ANGLTKILLLMQS NCSPQVR M +DLLK+FRVNSKS LSS Sbjct: 349 LWSVCYLFRDQKAQEAVTKANGLTKILLLMQS-NCSPQVRQMSSDLLKIFRVNSKSCLSS 407 Query: 181 YNTKTTHIVPF 213 Y+TKTTHI+PF Sbjct: 408 YDTKTTHIMPF 418 >ref|XP_003630199.1| U-box domain-containing protein [Medicago truncatula] gi|357519901|ref|XP_003630239.1| U-box domain-containing protein [Medicago truncatula] gi|355524221|gb|AET04675.1| U-box domain-containing protein [Medicago truncatula] gi|355524261|gb|AET04715.1| U-box domain-containing protein [Medicago truncatula] Length = 418 Score = 119 bits (297), Expect = 3e-25 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = +1 Query: 1 LWSVCYLFRDEKAREAVAEANGLTKILLLMQSSNCSPQVRLMCTDLLKVFRVNSKSILSS 180 LWSVCYLFRD+KA+EAV +ANGLTKILLLMQS NCSPQVR M DLLK+FRVNSKS LSS Sbjct: 349 LWSVCYLFRDQKAQEAVTKANGLTKILLLMQS-NCSPQVRQMSVDLLKIFRVNSKSCLSS 407 Query: 181 YNTKTTHIVPF 213 Y+TKTTHI+PF Sbjct: 408 YDTKTTHIMPF 418 >ref|XP_002517222.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223543593|gb|EEF45122.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 412 Score = 114 bits (285), Expect = 8e-24 Identities = 57/71 (80%), Positives = 63/71 (88%) Frame = +1 Query: 1 LWSVCYLFRDEKAREAVAEANGLTKILLLMQSSNCSPQVRLMCTDLLKVFRVNSKSILSS 180 LWS+CYLFRD KAREAV ++NGLTKILLLMQS NCSP VR M DLLK+FRVNSKS LSS Sbjct: 343 LWSLCYLFRDGKAREAVIKSNGLTKILLLMQS-NCSPAVRQMAADLLKIFRVNSKSCLSS 401 Query: 181 YNTKTTHIVPF 213 Y+TKTTHI+PF Sbjct: 402 YDTKTTHIMPF 412