BLASTX nr result
ID: Glycyrrhiza23_contig00027485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027485 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABH02877.1| MYB transcription factor MYB130 [Glycine max] 45 7e-08 >gb|ABH02877.1| MYB transcription factor MYB130 [Glycine max] Length = 305 Score = 44.7 bits (104), Expect(3) = 7e-08 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -3 Query: 287 CASCLFFIAVHNFGLVNLEYVGLFMKHFVRTQ 192 C +FF+ VHNF LVNLEY G FMK+ VR Q Sbjct: 274 CFLPVFFVTVHNFRLVNLEYAGSFMKYSVRNQ 305 Score = 33.1 bits (74), Expect(3) = 7e-08 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 Query: 315 SWLEIIVLPLCFLPVF 268 SWLE+IVL LCFLPVF Sbjct: 264 SWLEMIVLLLCFLPVF 279 Score = 22.7 bits (47), Expect(3) = 7e-08 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 349 WCGLLLVHHQ 320 WCGL HHQ Sbjct: 253 WCGLTHAHHQ 262