BLASTX nr result
ID: Glycyrrhiza23_contig00027421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027421 (598 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589912.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 55 7e-06 gb|EAY81382.1| hypothetical protein OsI_36553 [Oryza sativa Indi... 55 9e-06 >ref|XP_003589912.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355478960|gb|AES60163.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 1119 Score = 55.5 bits (132), Expect = 7e-06 Identities = 32/56 (57%), Positives = 33/56 (58%), Gaps = 16/56 (28%) Frame = +2 Query: 452 FKFDDERGTKEDTNRALVEQYGGEE----------------VKSYNAYMLVNIHES 571 FKFDDER TKEDTNRAL EQYGGEE K NAYMLV + ES Sbjct: 471 FKFDDERVTKEDTNRALEEQYGGEEELPLTNPGFNNSPFKFTKYSNAYMLVYVRES 526 >gb|EAY81382.1| hypothetical protein OsI_36553 [Oryza sativa Indica Group] Length = 1148 Score = 55.1 bits (131), Expect = 9e-06 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 16/61 (26%) Frame = +2 Query: 437 YLLLGFKFDDERGTKEDTNRALVEQYGGEE----------------VKSYNAYMLVNIHE 568 Y LL +KFDDER TKEDT +AL EQYGGEE K NAYMLV I E Sbjct: 462 YALLLYKFDDERVTKEDTKKALEEQYGGEEELPQINPGFNNAPFKFTKYSNAYMLVYIRE 521 Query: 569 S 571 S Sbjct: 522 S 522