BLASTX nr result
ID: Glycyrrhiza23_contig00027383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027383 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35708.1| unknown [Medicago truncatula] 68 7e-10 ref|XP_003594715.1| WRKY transcription factor [Medicago truncatu... 68 9e-10 ref|XP_003594714.1| WRKY transcription factor [Medicago truncatu... 68 9e-10 >gb|AFK35708.1| unknown [Medicago truncatula] Length = 379 Score = 68.2 bits (165), Expect = 7e-10 Identities = 42/75 (56%), Positives = 50/75 (66%), Gaps = 10/75 (13%) Frame = +3 Query: 57 DEIPGIST---NNLS-FPFQPNTTIFDTNMPSSPSCDQKASSFGFMDLLGAHDY-----N 209 DEIP +T NN S FPFQP+ + F +PSS SCDQK+SSFGFMDLLG+HDY N Sbjct: 29 DEIPTTTTAINNNTSLFPFQPSISTFFDTIPSS-SCDQKSSSFGFMDLLGSHDYINNNNN 87 Query: 210 TFLF-DCLPSATVAT 251 TFL D +P+ T Sbjct: 88 TFLLSDWVPTVATTT 102 >ref|XP_003594715.1| WRKY transcription factor [Medicago truncatula] gi|355483763|gb|AES64966.1| WRKY transcription factor [Medicago truncatula] Length = 205 Score = 67.8 bits (164), Expect = 9e-10 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 11/76 (14%) Frame = +3 Query: 57 DEIPGIST----NNLS-FPFQPNTTIFDTNMPSSPSCDQKASSFGFMDLLGAHDY----- 206 DEIP +T NN S FPFQP+ + F +PSS SCDQK+SSFGFMDLLG+HDY Sbjct: 5 DEIPTTTTTINNNNTSLFPFQPSISTFFDTIPSS-SCDQKSSSFGFMDLLGSHDYINNNN 63 Query: 207 NTFLF-DCLPSATVAT 251 NTFL D +P+ T Sbjct: 64 NTFLLSDWVPTVATTT 79 >ref|XP_003594714.1| WRKY transcription factor [Medicago truncatula] gi|355483762|gb|AES64965.1| WRKY transcription factor [Medicago truncatula] Length = 356 Score = 67.8 bits (164), Expect = 9e-10 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 11/76 (14%) Frame = +3 Query: 57 DEIPGIST----NNLS-FPFQPNTTIFDTNMPSSPSCDQKASSFGFMDLLGAHDY----- 206 DEIP +T NN S FPFQP+ + F +PSS SCDQK+SSFGFMDLLG+HDY Sbjct: 5 DEIPTTTTTINNNNTSLFPFQPSISTFFDTIPSS-SCDQKSSSFGFMDLLGSHDYINNNN 63 Query: 207 NTFLF-DCLPSATVAT 251 NTFL D +P+ T Sbjct: 64 NTFLLSDWVPTVATTT 79