BLASTX nr result
ID: Glycyrrhiza23_contig00027346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027346 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621596.1| Pentatricopeptide repeat-containing protein ... 82 6e-14 ref|XP_003531893.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|XP_003551784.1| PREDICTED: pentatricopeptide repeat-containi... 79 4e-13 ref|XP_002515260.1| pentatricopeptide repeat-containing protein,... 78 8e-13 ref|XP_003621600.1| Pentatricopeptide repeat-containing protein ... 74 9e-12 >ref|XP_003621596.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496611|gb|AES77814.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 849 Score = 81.6 bits (200), Expect = 6e-14 Identities = 46/68 (67%), Positives = 50/68 (73%) Frame = +2 Query: 2 KNGLVESSMMLLDAMIAEGIKPNVVTYNSIIDAFGQLSALECVVDTSLQATEYPTEHSSS 181 KNGLVESS+MLL AMI +GIKPNVVT+NSIIDA Q LE V S QA EYPTE SS Sbjct: 506 KNGLVESSIMLLIAMIEKGIKPNVVTFNSIIDASRQSPTLEYGVHGSSQAVEYPTEQLSS 565 Query: 182 MVITGTNQ 205 M+I G Q Sbjct: 566 MLIDGAFQ 573 >ref|XP_003531893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Glycine max] Length = 878 Score = 79.3 bits (194), Expect = 3e-13 Identities = 43/71 (60%), Positives = 50/71 (70%), Gaps = 3/71 (4%) Frame = +2 Query: 2 KNGLVESSMMLLDAMIAEGIKPNVVTYNSIIDAF---GQLSALECVVDTSLQATEYPTEH 172 KNGL+ESS+ LLD M +G +PNVVTYNSIIDAF QL ALEC VDT QA E+ + Sbjct: 519 KNGLIESSLRLLDVMTEKGSRPNVVTYNSIIDAFKIGQQLPALECAVDTPFQANEHQIKP 578 Query: 173 SSSMVITGTNQ 205 SSS +I G Q Sbjct: 579 SSSRLIVGNFQ 589 >ref|XP_003551784.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Glycine max] Length = 875 Score = 79.0 bits (193), Expect = 4e-13 Identities = 43/71 (60%), Positives = 50/71 (70%), Gaps = 3/71 (4%) Frame = +2 Query: 2 KNGLVESSMMLLDAMIAEGIKPNVVTYNSIIDAF---GQLSALECVVDTSLQATEYPTEH 172 KNGL+ESS+ LLD M +G +PNVVTYNSIIDAF QL ALEC VDTS QA E+ + Sbjct: 518 KNGLIESSLRLLDVMTEKGSRPNVVTYNSIIDAFRIGQQLPALECAVDTSFQANEHQIKP 577 Query: 173 SSSMVITGTNQ 205 SSS + G Q Sbjct: 578 SSSRLSAGNFQ 588 >ref|XP_002515260.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545740|gb|EEF47244.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 878 Score = 77.8 bits (190), Expect = 8e-13 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = +2 Query: 2 KNGLVESSMMLLDAMIAEGIKPNVVTYNSIIDAFGQLSALECVVDTSLQATEYPTEHSSS 181 KNGLVESS+ LLD M EGI+PNVVTYNSIIDAFG+ ++ +CVVD S + T E SS Sbjct: 518 KNGLVESSVTLLDEMTKEGIRPNVVTYNSIIDAFGRSASAQCVVDDSGETTALQVESLSS 577 Query: 182 MVI 190 +V+ Sbjct: 578 IVV 580 >ref|XP_003621600.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355496615|gb|AES77818.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 890 Score = 74.3 bits (181), Expect = 9e-12 Identities = 41/68 (60%), Positives = 49/68 (72%) Frame = +2 Query: 2 KNGLVESSMMLLDAMIAEGIKPNVVTYNSIIDAFGQLSALECVVDTSLQATEYPTEHSSS 181 KNGL+ESS+MLL AM+ +GIKPNVVT+NSIIDA Q LE V+ S A +YP E SS Sbjct: 541 KNGLMESSIMLLMAMMEKGIKPNVVTFNSIIDASQQSPTLEYGVNGSSDAIDYPIEQSSP 600 Query: 182 MVITGTNQ 205 +VI G Q Sbjct: 601 IVIDGAFQ 608