BLASTX nr result
ID: Glycyrrhiza23_contig00027184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027184 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ... 55 6e-06 ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ... 54 1e-05 >ref|XP_003548315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 772 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 15 RSRAALRIQAAWRYRKKRLSRANTSQTDQTL 107 RS AA RIQ AWRYRKKRLSRANTSQ+DQTL Sbjct: 740 RSLAANRIQVAWRYRKKRLSRANTSQSDQTL 770 >ref|XP_003534111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Glycine max] Length = 770 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 15 RSRAALRIQAAWRYRKKRLSRANTSQTDQTLKS 113 RS AA RIQ AWRYRKKRLSRANTSQ++QTL S Sbjct: 738 RSLAANRIQVAWRYRKKRLSRANTSQSNQTLMS 770