BLASTX nr result
ID: Glycyrrhiza23_contig00027140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027140 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527999.1| PREDICTED: uncharacterized protein LOC100776... 80 1e-13 ref|XP_003602376.1| hypothetical protein MTR_3g092670 [Medicago ... 80 1e-13 >ref|XP_003527999.1| PREDICTED: uncharacterized protein LOC100776590 [Glycine max] Length = 238 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -2 Query: 170 MICSARTGKSGSNWLDRLRSNKGIPTGDDLDLDSFLHRLNTHTHSPQARPTDP 12 M+CS +TGKSG NWLDRLRSNKGIPTGD+ DLDSFL L+ SPQARP DP Sbjct: 1 MLCSPQTGKSGLNWLDRLRSNKGIPTGDEPDLDSFL--LSAPPQSPQARPNDP 51 >ref|XP_003602376.1| hypothetical protein MTR_3g092670 [Medicago truncatula] gi|355491424|gb|AES72627.1| hypothetical protein MTR_3g092670 [Medicago truncatula] Length = 216 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = -2 Query: 170 MICSARTGKSGSNWLDRLRSNKGIPTGDDLDLDSFLHRLNTHTHSPQARPTDPAR 6 MICS R+ K GSNWLDRLRSNKGIPT D+LDLD+F+ LN THSPQ RP P R Sbjct: 1 MICSPRSNKPGSNWLDRLRSNKGIPTDDNLDLDTFI--LNLATHSPQPRPIKPLR 53