BLASTX nr result
ID: Glycyrrhiza23_contig00027076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027076 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530672.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 ref|XP_003630933.1| Tau class glutathione S-transferase [Medicag... 87 1e-15 ref|XP_002268680.2| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 emb|CBI32045.3| unnamed protein product [Vitis vinifera] 81 1e-13 gb|AAD30619.1|AC007153_11 similar to indole-3-acetate beta-gluco... 80 3e-13 >ref|XP_003530672.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Glycine max] Length = 742 Score = 88.2 bits (217), Expect = 8e-16 Identities = 37/63 (58%), Positives = 52/63 (82%) Frame = -3 Query: 198 SILDADLVRHVSSTLKRRRSEPLRDVLKPYESRFKPHHHLIIWVLMDIKTDYRLVLDFFN 19 S+ D D V H+S+T+K+RR+EP R +LKP+ES+F+P H +IWVLM I+ DY+LVLDFF+ Sbjct: 58 SVTDTDFVHHISTTIKQRRAEPFRRILKPFESKFRPDH--LIWVLMSIRDDYKLVLDFFD 115 Query: 18 WSR 10 W+R Sbjct: 116 WAR 118 >ref|XP_003630933.1| Tau class glutathione S-transferase [Medicago truncatula] gi|355524955|gb|AET05409.1| Tau class glutathione S-transferase [Medicago truncatula] Length = 1320 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -3 Query: 198 SILDADLVRHVSSTLKRRRSEPLRDVLKPYESRFKPHHHLIIWVLMDIKTDYRLVLDFFN 19 SI D DLVR V++TLKRR EP R VLKPYESRFKP H +IWVL+++K DY LVL+ FN Sbjct: 44 SISDTDLVRRVTTTLKRRHLEPFRRVLKPYESRFKPSH--LIWVLINLKNDYPLVLNLFN 101 Query: 18 WSRS 7 W++S Sbjct: 102 WAKS 105 >ref|XP_002268680.2| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Vitis vinifera] Length = 748 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/61 (62%), Positives = 48/61 (78%) Frame = -3 Query: 195 ILDADLVRHVSSTLKRRRSEPLRDVLKPYESRFKPHHHLIIWVLMDIKTDYRLVLDFFNW 16 I D++LV +S +K+RRSEPLR VLKPYES+F+ H +IWVLM+IK DYRLVL FF W Sbjct: 60 IQDSELVHRISIAIKQRRSEPLRRVLKPYESKFRADH--LIWVLMNIKNDYRLVLSFFEW 117 Query: 15 S 13 + Sbjct: 118 A 118 >emb|CBI32045.3| unnamed protein product [Vitis vinifera] Length = 648 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/61 (62%), Positives = 48/61 (78%) Frame = -3 Query: 195 ILDADLVRHVSSTLKRRRSEPLRDVLKPYESRFKPHHHLIIWVLMDIKTDYRLVLDFFNW 16 I D++LV +S +K+RRSEPLR VLKPYES+F+ H +IWVLM+IK DYRLVL FF W Sbjct: 60 IQDSELVHRISIAIKQRRSEPLRRVLKPYESKFRADH--LIWVLMNIKNDYRLVLSFFEW 117 Query: 15 S 13 + Sbjct: 118 A 118 >gb|AAD30619.1|AC007153_11 similar to indole-3-acetate beta-glucosyltransferase [Arabidopsis thaliana] Length = 1184 Score = 79.7 bits (195), Expect = 3e-13 Identities = 37/64 (57%), Positives = 48/64 (75%) Frame = -3 Query: 198 SILDADLVRHVSSTLKRRRSEPLRDVLKPYESRFKPHHHLIIWVLMDIKTDYRLVLDFFN 19 S+ D + V +++ +K RR+EPLR LKPYE +FK H +IWVLM IK DYRLVLDFF+ Sbjct: 495 SVRDTEFVHQITNVIKLRRAEPLRRSLKPYECKFKTDH--LIWVLMKIKCDYRLVLDFFD 552 Query: 18 WSRS 7 W+RS Sbjct: 553 WARS 556