BLASTX nr result
ID: Glycyrrhiza23_contig00027071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027071 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612759.1| Nbs-lrr resistance protein [Medicago truncat... 65 1e-08 ref|XP_003612744.1| hypothetical protein MTR_5g028420 [Medicago ... 56 4e-06 >ref|XP_003612759.1| Nbs-lrr resistance protein [Medicago truncatula] gi|355514094|gb|AES95717.1| Nbs-lrr resistance protein [Medicago truncatula] Length = 1082 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +3 Query: 156 SIGDLKNVRYLDLSLNNMEKLFDSITKLTNLQTLKLSQYYLVKE 287 SIGD+ N+RYLDLSLN++EKL +SITKL+NLQTLKLSQ Y ++E Sbjct: 565 SIGDMNNLRYLDLSLNSIEKLPNSITKLSNLQTLKLSQCYPLEE 608 >ref|XP_003612744.1| hypothetical protein MTR_5g028420 [Medicago truncatula] gi|355514079|gb|AES95702.1| hypothetical protein MTR_5g028420 [Medicago truncatula] Length = 1097 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 156 SIGDLKNVRYLDLSLNNMEKLFDSITKLTNLQTLKLSQYYLVKE 287 SI ++K +RYLDLS NN+EKL SITKL +LQTLKLSQ +++KE Sbjct: 562 SIEEVKYLRYLDLSHNNIEKLPSSITKLIHLQTLKLSQCHILKE 605