BLASTX nr result
ID: Glycyrrhiza23_contig00027004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00027004 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003555375.1| PREDICTED: heat stress transcription factor ... 79 5e-13 ref|XP_003535620.1| PREDICTED: heat stress transcription factor ... 72 6e-11 ref|XP_003548209.1| PREDICTED: heat stress transcription factor ... 71 8e-11 ref|XP_004143930.1| PREDICTED: heat stress transcription factor ... 69 5e-10 ref|XP_002510816.1| Heat shock factor protein, putative [Ricinus... 69 5e-10 >ref|XP_003555375.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine max] Length = 300 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 131 MAPPAEHNGHSSTGESQRSIPTPFLTKTYQLVEDQSIDDVISW 3 MAPP EHNG S++G+SQRSIPTPFLTKTYQLV+D +IDDVISW Sbjct: 1 MAPPLEHNGVSTSGDSQRSIPTPFLTKTYQLVDDHTIDDVISW 43 >ref|XP_003535620.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine max] Length = 289 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -1 Query: 131 MAPPAEHNGHSSTGESQRSIPTPFLTKTYQLVEDQSIDDVISW 3 MAPP EHNG S++G+S RSIPTPFLTKT+QLV+D +ID VISW Sbjct: 1 MAPPLEHNGVSTSGDSLRSIPTPFLTKTFQLVDDHTIDHVISW 43 >ref|XP_003548209.1| PREDICTED: heat stress transcription factor B-2a-like [Glycine max] Length = 348 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 7/48 (14%) Frame = -1 Query: 125 PPAEHNGHSS-------TGESQRSIPTPFLTKTYQLVEDQSIDDVISW 3 PP EHNG S+ + ESQRSIPTPFLTKTYQLV+DQSIDDVISW Sbjct: 5 PPVEHNGDSAATASASASAESQRSIPTPFLTKTYQLVDDQSIDDVISW 52 >ref|XP_004143930.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] gi|449534034|ref|XP_004173974.1| PREDICTED: heat stress transcription factor B-2b-like [Cucumis sativus] Length = 341 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -1 Query: 131 MAP-PAEHNGHSSTGESQRSIPTPFLTKTYQLVEDQSIDDVISW 3 MAP PAE G S TG+SQRSIPTPFLTKTYQLV+D ++DD+ISW Sbjct: 1 MAPSPAEPIGDSGTGDSQRSIPTPFLTKTYQLVDDPAVDDLISW 44 >ref|XP_002510816.1| Heat shock factor protein, putative [Ricinus communis] gi|223549931|gb|EEF51418.1| Heat shock factor protein, putative [Ricinus communis] Length = 323 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 125 PPAEHNGHSSTGESQRSIPTPFLTKTYQLVEDQSIDDVISW 3 PP E NG ++ ESQRSIPTPFLTKTYQLV+D +IDDVISW Sbjct: 4 PPGEQNGDAAMVESQRSIPTPFLTKTYQLVDDPAIDDVISW 44