BLASTX nr result
ID: Glycyrrhiza23_contig00026923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00026923 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636898.1| Xylem serine proteinase [Medicago truncatula... 76 3e-12 ref|XP_003623809.1| Xylem serine proteinase [Medicago truncatula... 67 2e-09 ref|XP_003533628.1| PREDICTED: xylem serine proteinase 1-like [G... 66 3e-09 ref|XP_002272598.1| PREDICTED: xylem serine proteinase 1 [Vitis ... 65 4e-09 gb|AAC19302.1| contains similarity to the subtilase family of se... 62 4e-08 >ref|XP_003636898.1| Xylem serine proteinase [Medicago truncatula] gi|355502833|gb|AES84036.1| Xylem serine proteinase [Medicago truncatula] Length = 718 Score = 76.3 bits (186), Expect = 3e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 RSFKVVVKAKSMASMQIVSGSLIWRSPRYIVRSPIVIYSP 120 RSFKVVVKAKSMASM+IVS SLIWRSPRYIVRSPIVIYSP Sbjct: 679 RSFKVVVKAKSMASMKIVSASLIWRSPRYIVRSPIVIYSP 718 >ref|XP_003623809.1| Xylem serine proteinase [Medicago truncatula] gi|355498824|gb|AES80027.1| Xylem serine proteinase [Medicago truncatula] Length = 900 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = +1 Query: 1 RSFKVVVKAKSM-ASMQIVSGSLIWRSPRYIVRSPIVIYSP 120 RSFKV+VK KS+ SM+I+SGSLIWRSPRYIVRSPIVIY P Sbjct: 860 RSFKVIVKVKSIITSMEILSGSLIWRSPRYIVRSPIVIYKP 900 >ref|XP_003533628.1| PREDICTED: xylem serine proteinase 1-like [Glycine max] Length = 732 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 1 RSFKVVVKAKSMASMQIVSGSLIWRSPRYIVRSPIVIYSP 120 RSFKVVVKA S+ S +IVSGSLIWRSPRYIVRSPIVI +P Sbjct: 693 RSFKVVVKATSIGSEKIVSGSLIWRSPRYIVRSPIVINNP 732 >ref|XP_002272598.1| PREDICTED: xylem serine proteinase 1 [Vitis vinifera] gi|296089126|emb|CBI38829.3| unnamed protein product [Vitis vinifera] Length = 736 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 RSFKVVVKAKSMASMQIVSGSLIWRSPRYIVRSPIVIYSP 120 RSFKVVVKAKS A ++VSGSL WRSPR+IVRSPIVIY P Sbjct: 697 RSFKVVVKAKSTAFKEMVSGSLTWRSPRHIVRSPIVIYKP 736 >gb|AAC19302.1| contains similarity to the subtilase family of serine proteases (Pfam: subtilase.hmm, score: 47.57); strong similarity to Cucumis melo (muskmelon) cucumisin (GB:D32206) [Arabidopsis thaliana] gi|7267110|emb|CAB80781.1| putative cucumisin protease [Arabidopsis thaliana] Length = 706 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 1 RSFKVVVKAKSMASMQIVSGSLIWRSPRYIVRSPIVIYSP 120 RSFKVVVKAK M +IVSG L+W+SPR+ VRSPIVIYSP Sbjct: 664 RSFKVVVKAKQMTPGKIVSGLLVWKSPRHSVRSPIVIYSP 703