BLASTX nr result
ID: Glycyrrhiza23_contig00026878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00026878 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539435.1| PREDICTED: zinc transporter ZTP29-like [Glyc... 63 2e-08 ref|XP_003537960.1| PREDICTED: zinc transporter ZTP29-like [Glyc... 63 2e-08 ref|XP_003547105.1| PREDICTED: zinc transporter ZTP29-like [Glyc... 58 7e-07 ref|XP_003543542.1| PREDICTED: zinc transporter ZTP29-like [Glyc... 58 7e-07 ref|XP_002513470.1| integral membrane protein, putative [Ricinus... 57 1e-06 >ref|XP_003539435.1| PREDICTED: zinc transporter ZTP29-like [Glycine max] Length = 272 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 323 AGQKQSVKAVFCGMAFMSASLYFLRMSLPED 231 AGQKQSVKAVFCGMAFMSASLYFLR+SLPED Sbjct: 241 AGQKQSVKAVFCGMAFMSASLYFLRISLPED 271 >ref|XP_003537960.1| PREDICTED: zinc transporter ZTP29-like [Glycine max] Length = 272 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 323 AGQKQSVKAVFCGMAFMSASLYFLRMSLPED 231 AGQKQSVKAVFCGMAFMSASLYFLR+SLPED Sbjct: 241 AGQKQSVKAVFCGMAFMSASLYFLRISLPED 271 >ref|XP_003547105.1| PREDICTED: zinc transporter ZTP29-like [Glycine max] Length = 276 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 323 AGQKQSVKAVFCGMAFMSASLYFLRMSLPEDTGL 222 AGQKQSVKAVF GMAFMSASLYFL +SLPED L Sbjct: 243 AGQKQSVKAVFLGMAFMSASLYFLSISLPEDLSL 276 >ref|XP_003543542.1| PREDICTED: zinc transporter ZTP29-like [Glycine max] Length = 276 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 323 AGQKQSVKAVFCGMAFMSASLYFLRMSLPEDTGL 222 AGQKQSVKAVF GMAFMSASLYFL +SLPED L Sbjct: 243 AGQKQSVKAVFLGMAFMSASLYFLSISLPEDLSL 276 >ref|XP_002513470.1| integral membrane protein, putative [Ricinus communis] gi|223547378|gb|EEF48873.1| integral membrane protein, putative [Ricinus communis] Length = 276 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 323 AGQKQSVKAVFCGMAFMSASLYFLRMSLPEDTGL 222 AGQKQ+VKAVF GMAFMSASLYFL +SLPED L Sbjct: 243 AGQKQAVKAVFLGMAFMSASLYFLEISLPEDISL 276