BLASTX nr result
ID: Glycyrrhiza23_contig00026855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00026855 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109494.1| hypothetical protein Poptr_cp015 [Populus tr... 59 4e-07 >ref|YP_001109494.1| hypothetical protein Poptr_cp015 [Populus trichocarpa] gi|133712054|gb|ABO36697.1| conserved hypothetical protein [Populus trichocarpa] Length = 56 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = -2 Query: 137 GVQTSIKNKKRS--TVRISFLSNLNIRIVNIVMIQWVRSTYFFF 12 GVQ ++K K++S TV IS +SNL IRIV+IVMIQWVRSTYFFF Sbjct: 12 GVQRNMKMKEKSGSTVPISSISNLTIRIVDIVMIQWVRSTYFFF 55