BLASTX nr result
ID: Glycyrrhiza23_contig00026621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00026621 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002466618.1| hypothetical protein SORBIDRAFT_01g011130 [S... 63 3e-08 >ref|XP_002466618.1| hypothetical protein SORBIDRAFT_01g011130 [Sorghum bicolor] gi|241920472|gb|EER93616.1| hypothetical protein SORBIDRAFT_01g011130 [Sorghum bicolor] Length = 463 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = +3 Query: 3 FLWQFCHASTPVREVLSSRGVQLVGDCPCCNALPETLAHCFFTCPQAAQVWQLFWIGT 176 FLW+F H S P+R+ L RG+++V CP CN + E H FF C A QVW+L + T Sbjct: 157 FLWRFLHNSHPLRDNLIRRGMEIVPRCPVCNQVGEDGGHLFFKCGMARQVWELLGLST 214