BLASTX nr result
ID: Glycyrrhiza23_contig00025986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00025986 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238417.1| serine/threonine protein kinase family prote... 65 4e-09 >ref|NP_001238417.1| serine/threonine protein kinase family protein [Glycine max] gi|223452282|gb|ACM89469.1| serine/threonine protein kinase family protein [Glycine max] Length = 672 Score = 65.5 bits (158), Expect = 4e-09 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Frame = -2 Query: 227 FFNYTSNDDDYTLLFDCDAP-SYTSSVNSDSSILFSCLIDGDPDKPRDGYLVLSTKVVDF 51 FFNYTSNDDDYTLL+DC P +YTSSVN +I FSC ID RD + L Sbjct: 122 FFNYTSNDDDYTLLYDCGPPVTYTSSVNIKGTISFSCPIDSG---FRDAFFDLG------ 172 Query: 50 NVLRCKNRINVPVLK 6 CK+ INV VL+ Sbjct: 173 ----CKHSINVSVLR 183